Dynamin 3 Antibody (5X7T4) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 700-800 of human Dynamin 3 (Q9UQ16). ELLAQLYSSEDQNTLMEESAEQAQRRDEMLRMYQALKEALGIIGDISTATVSTPAPPPVDDSWIQHSRRSPPPSPTTQRRPTLSAPLARPTSGRGPAPAIP |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
DNM3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Dynamin 3 Antibody (5X7T4)
Background
The dynamins are a family of 100 kDa GTPases transcribed from at least three separate genes. At least four mRNA splice variants for each dynamin have been described. Dynamins contain several conserved regions including the conserved, amino-terminal GTPase domain, a centrally located membrane-binding plekstrin homology domain (PHD), and a coiled-coil region located in front of a proline-rich domain (PRD). The PRD is thought to mediate interactions between dynamin and numerous other cellular proteins. Dynamin 1 is expressed exclusively in neurons, Dynamin 2 is ubiquitously expressed, and Dynamin 3 is thought to be restricted to expression in the brain, testis, heart, and lung. The dynamins participate in the cellular process of clathrin-mediated and fluid-phase endocytosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-Fr, IHC-P, IP, KO, Simple Western, WB
Species: Fi, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Ch, Hu, Mu, Po, Rt, Ze
Applications: IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Publications for Dynamin 3 Antibody (NBP3-15722) (0)
There are no publications for Dynamin 3 Antibody (NBP3-15722).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Dynamin 3 Antibody (NBP3-15722) (0)
There are no reviews for Dynamin 3 Antibody (NBP3-15722).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Dynamin 3 Antibody (NBP3-15722) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Dynamin 3 Products
Research Areas for Dynamin 3 Antibody (NBP3-15722)
Find related products by research area.
|
Blogs on Dynamin 3