Dynactin Subunit 2/DCTN2/DCTN-50 Recombinant Protein Antigen

Images

 
There are currently no images for Dynactin Subunit 2/DCTN2/DCTN-50 Protein (NBP1-85277PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Dynactin Subunit 2/DCTN2/DCTN-50 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DCTN2.

Source: E. coli

Amino Acid Sequence: RWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DCTN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85277.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Dynactin Subunit 2/DCTN2/DCTN-50 Recombinant Protein Antigen

  • DCTN2
  • DCTN-50
  • DCTN5050 kD dynein-associated polypeptide
  • dynactin 2 (p50)
  • dynactin complex 50 kD subunit
  • Dynactin complex 50 kDa subunit
  • Dynactin Subunit 2
  • dynactin subunit 2,50 kDa dynein-associated polypeptide
  • Dynamitin
  • p50 dynamitin
  • RBP50

Background

Dynactin subunit 2 encodes a 50-kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p150) of dynactin and may affix p150 in place.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP1-88650
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP2-01345
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
H00008518-M03
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NB500-207
Species: Hu
Applications: ICC/IF, IP, WB
AF2335
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
NB100-68205
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-30463
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IP, WB
PP-H7147-00
Species: Hu
Applications: IHC, IP, WB
NBP2-14306
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-15274
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-88848
Species: Hu
Applications: IHC,  IHC-P
AF2204
Species: Hu
Applications: IHC, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF7388
Species: Hu
Applications: IHC
NBP1-83936
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-85277PEP
Species: Hu
Applications: AC

Publications for Dynactin Subunit 2/DCTN2/DCTN-50 Protein (NBP1-85277PEP) (0)

There are no publications for Dynactin Subunit 2/DCTN2/DCTN-50 Protein (NBP1-85277PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dynactin Subunit 2/DCTN2/DCTN-50 Protein (NBP1-85277PEP) (0)

There are no reviews for Dynactin Subunit 2/DCTN2/DCTN-50 Protein (NBP1-85277PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Dynactin Subunit 2/DCTN2/DCTN-50 Protein (NBP1-85277PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dynactin Subunit 2/DCTN2/DCTN-50 Products

Research Areas for Dynactin Subunit 2/DCTN2/DCTN-50 Protein (NBP1-85277PEP)

Find related products by research area.

Blogs on Dynactin Subunit 2/DCTN2/DCTN-50

There are no specific blogs for Dynactin Subunit 2/DCTN2/DCTN-50, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Dynactin Subunit 2/DCTN2/DCTN-50 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DCTN2