![Western Blot: DUSP26 Antibody [NBP2-33880] - Analysis in control (vector only transfected HEK293T lysate) and DUSP26 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/DUSP26-Antibody-Western-Blot-NBP2-33880-img0006.jpg "Western Blot: DUSP26 Antibody [NBP2-33880] - Analysis in control (vector only transfected HEK293T lysate) and DUSP26 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit DUSP26 Antibody - BSA Free (NBP2-33880) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DUSP26 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Bioactivity C1QL1 [Unconjugated]](https://images.novusbio.com/images2/C1qL1_9134TN_1238.jpg)
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for DUSP26 Antibody (NBP2-33880)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: DUSP26 Antibody [NBP2-33880] - Staining of human cell line SH-SY5Y shows localization to nucleus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/DUSP26-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33880-img0007.jpg "Immunocytochemistry/Immunofluorescence: DUSP26 Antibody [NBP2-33880] - Staining of human cell line SH-SY5Y shows localization to nucleus. Antibody staining is shown in green.")
![Immunohistochemistry: DUSP26 Antibody [NBP2-33880] - Staining of human prostate shows strong positivity in basal cells.](http://images.novusbio.com/fullsize/DUSP26-Antibody-Immunohistochemistry-NBP2-33880-img0001.jpg "Immunohistochemistry: DUSP26 Antibody [NBP2-33880] - Staining of human prostate shows strong positivity in basal cells.")
![N/A Neutrophil Elastase/ELA2 [Biotin]](https://images.novusbio.com/images2/DATA_Neutrophil_Elastase_DY451705_ELISA_2461.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Simple Western p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/16324.jpg)
![Western Blot p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Western_Blot_22371.jpg)
![Immunohistochemistry p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Immunohistochemistry_7087.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")