DTX3 Antibody (4F10) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse DTX3 Antibody (4F10) - Azide and BSA Free (H00196403-M01) is a monoclonal antibody validated for use in ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
DTX3 (NP_848597, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MCGRFYGQLVGNQPQNGRMLVSKDATLLLPSYEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTLFRKAFDQRLTFTIGTSMTT |
| Specificity |
DTX3 - deltex 3 homolog (Drosophila) |
| Isotype |
IgG3 Lambda |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
DTX3 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against recombinant protein on ELISA. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for DTX3 Antibody (4F10) - Azide and BSA Free
Background
DTX3 encodes a probable E3 ubiquitin-protein ligase DTX3 that exists in two isoforms: Isoform 1 id 347 amino acids long at nearly 38 kDA, while isoform 2 is 350 amino acids long at 38 kDA as well. DTX3 is involved in the notch signaling pathway and protein modification and is known to interact with genes UBE2D2, UBE2D3, UBE2L6, UBE2V1, and UBE2W. It is critical in cell to cell communication that affects cell-fate determinations.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA, WB
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Mu
Applications: IHC, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ELISA
Publications for DTX3 Antibody (H00196403-M01) (0)
There are no publications for DTX3 Antibody (H00196403-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DTX3 Antibody (H00196403-M01) (0)
There are no reviews for DTX3 Antibody (H00196403-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for DTX3 Antibody (H00196403-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DTX3 Products
Research Areas for DTX3 Antibody (H00196403-M01)
Find related products by research area.
|
Blogs on DTX3