We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DSCAM Recombinant Protein Antigen

Images

 
There are currently no images for DSCAM Recombinant Protein Antigen (NBP3-17835PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DSCAM Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DSCAM

Source: E. coli

Amino Acid Sequence: QDGGRVMNMAVPKAHRPGDLIHLPPYLRMDFLLNRGGPGTSRDLSLGQACLEPQKSRTLK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DSCAM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17835.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DSCAM Recombinant Protein Antigen

  • CHD2-42
  • CHD2-52
  • Down syndrome cell adhesion molecule
  • DSCAM
  • human CHD2-52 down syndrome cell adhesion molecule, 10CHD2

Background

The Dscam gene encodes a large family of axon guidance receptors and immune receptors via alternative splicing, generating over 38000 isoforms. The gene has been shown to be required for axon guidance, specifically targeting individual neurons to their targets. The gene has also been shown to be involved in the immune system of the fly; different isoforms interact with different pathogens to elicit an immune response.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3315
Species: Hu
Applications: CyTOF-ready, Flow, WB
AF844
Species: Mu
Applications: Block, IHC, WB
NBP1-86687
Species: Hu
Applications: IHC,  IHC-P, WB
1109-N1
Species: Mu
Applications: Bind
NBP1-82648
Species: Hu
Applications: ICC/IF,  IHC-P, WB
NBP3-48017
Species: Hu, Mu, Rt
Applications: ELISA, WB
AF5890
Species: Mu
Applications: IHC, Simple Western, WB
NB100-60411
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IP, KD, KO, WB
NBP1-83242
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56159
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-85802
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00001859-M01
Species: Hu, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-46853
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-16632
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF2185
Species: Hu, Mu, Rt
Applications: IP, WB
NBP1-88191
Species: Hu
Applications: IHC,  IHC-P, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P

Publications for DSCAM Recombinant Protein Antigen (NBP3-17835PEP) (0)

There are no publications for DSCAM Recombinant Protein Antigen (NBP3-17835PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DSCAM Recombinant Protein Antigen (NBP3-17835PEP) (0)

There are no reviews for DSCAM Recombinant Protein Antigen (NBP3-17835PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DSCAM Recombinant Protein Antigen (NBP3-17835PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DSCAM Products

Blogs on DSCAM.

Untangling the contribution of the enteric nervous system to intestinal and extraintestinal disease
By Emily Cartwright, PhD What is the ENS?When it's late in the afternoon and you smell a delicious bag of popcorn in the microwave, your mouth begins to water and your stomach starts to grumble. These behaviors ar...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DSCAM Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DSCAM