Reactivity | HuSpecies Glossary |
Applications | AC |
Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DSCAM Source: E.coli Amino Acid Sequence: QDGGRVMNMAVPKAHRPGDLIHLPPYLRMDFLLNRGGPGTSRDLSLGQACLEPQKSRTLK |
Protein/Peptide Type | Recombinant Protein Antigen |
Gene | DSCAM |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Dilutions |
|
Application Notes | This peptide is useful as a blocking peptide for NBP3-17835. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here. |
Theoretical MW | 24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 1M Urea, pH 7.4. |
Preservative | No Preservative |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Diseases for DSCAM Recombinant Protein Antigen (NBP3-17835PEP)Discover more about diseases related to DSCAM Recombinant Protein Antigen (NBP3-17835PEP).
| Pathways for DSCAM Recombinant Protein Antigen (NBP3-17835PEP)View related products by pathway.
|
PTMs for DSCAM Recombinant Protein Antigen (NBP3-17835PEP)Learn more about PTMs related to DSCAM Recombinant Protein Antigen (NBP3-17835PEP).
|
Untangling the contribution of the enteric nervous system to intestinal and extraintestinal disease By Emily Cartwright, PhD What is the ENS?When it's late in the afternoon and you smell a delicious bag of popcorn in the microwave, your mouth begins to water and your stomach starts to grumble. These behaviors ar... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | DSCAM |