DRP2 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of DRP2. Peptide sequence: LEEPHSESKDTSPKQRIQNLSRFVWKQATVASELWEKLTARCVDQHRHIE The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DRP2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for DRP2 Antibody - BSA Free
Background
Dystrophin, utrophin and dystrophin-related protein 2 (DRP2) are Actin-binding proteins that are involved in anchoring the cytoskeleton to the plasma membrane. Dystrophin is the protein product of the Duchenne/Becker muscular dystrophy gene. Dystrophin is expressed in muscle and brain tissues, where it is localized to the inner surface of the plasma membrane. Evidence suggests that the upregulation of utrophin (also known as DRP1) can reduce the dystrophic pathology. DRP2 is principally expressed in the brain and spinal cord. Analysis of DRP2 expression in rat brain on SDS-PAGE reveals a characteristic quartet of bands from 100-120 kDa. DRP2 exhibits a punctate staining pattern of rat neuronal dendrites and in neuropil. DRP2 forms a complex with dystroglycan at the surface of myelin-forming Schwann cells and may play a role in the terminal stages of myelinogenesis in the peripheral nervous system. The gene encoding human DRP2 maps to chromosome Xq22.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Fe, Hu
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, WB
Species: Fi, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-Fr, IHC-P, IP, KO, Simple Western, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: WB
Publications for DRP2 Antibody (NBP2-84822) (0)
There are no publications for DRP2 Antibody (NBP2-84822).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DRP2 Antibody (NBP2-84822) (0)
There are no reviews for DRP2 Antibody (NBP2-84822).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DRP2 Antibody (NBP2-84822) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DRP2 Products
Research Areas for DRP2 Antibody (NBP2-84822)
Find related products by research area.
|
Blogs on DRP2