Drosha Antibody - BSA Free

Western Blot: Drosha Antibody [NBP1-57139] - Human Spleen lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Drosha Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to RNASEN(ribonuclease type III, nuclear) The peptide sequence was selected from the middle region of RNASEN. Peptide sequence AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DROSHA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Drosha Antibody - BSA Free

• drosha, double-stranded RNA-specific endoribonuclease
• drosha, ribonuclease type III
• EC 3.1.26.3
• ETOHI2
• nuclear RNase III Drosha
• p241
• Protein Drosha
• putative protein p241 which interacts with transcription factor Sp1
• putative ribonuclease III
• RANSE3L
• ribonuclease 3
• Ribonuclease III
• ribonuclease III, nuclear
• RN3nuclear
• RNase III

Background

RNASEN is a ribonuclease III double-stranded (ds) RNA-specific endoribonuclease that is involved in the initial step of microRNA (miRNA) biogenesis. Component of the microprocessor complex that is required to process primary miRNA transcripts (pri-miRNAs) to release precursor miRNA (pre-miRNA) in the nucleus. Within the microprocessor complex, RNASEN/DROSHA cleaves the 3' and 5' strands of a stem-loop in pri-miRNAs (processing center 11 bp from the dsRNA-ssRNA junction) to release hairpin-shaped pre-miRNAs that are subsequently cut by the cytoplasmic DICER to generate mature miRNAs. RNASEN is also involved in pre-rRNA processing. RNASEN cleaves double-strand RNA and does not cleave single-strand RNA. RNASEN is involved in the formation of GW bodies.Members of the ribonuclease III superfamily of double-stranded (ds) RNA-specific endoribonucleases participate in diverse RNA maturation and decay pathways in eukaryotic and prokaryotic cells (Fortin et al., 2002 [PubMed 12191433]). The RNase III Drosha is the core nuclease that executes the initiation step of microRNA (miRNA) processing in the nucleus (Lee et al., 2003 [PubMed 14508493]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DROSHA
• Uniprot:
  • Q9NRR4(Human)