Drebrin 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Drebrin 1 Antibody [NBP2-38650] -Analysis in human cerebral cortex and liver tissues using NBP2-38650 antibody. Corresponding DBN1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Drebrin 1 Antibody [NBP2-38650] - Staining of human cerebral cortex, kidney, pancreas and testis using Anti-DBN1 antibody NBP2-38650 (A) shows similar protein distribution across tissues to independent antibody NBP2-38813 (B).

Immunocytochemistry/Immunofluorescence: Drebrin 1 Antibody [NBP2-38650] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & actin filaments.

Immunohistochemistry-Paraffin: Drebrin 1 Antibody [NBP2-38650] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: Drebrin 1 Antibody [NBP2-38650] - Staining of human testis shows strong membranous positivity in spermatogonia.

Immunohistochemistry-Paraffin: Drebrin 1 Antibody [NBP2-38650] - Staining of human kidney shows strong membranous positivity in cells in tubules.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Drebrin 1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DBN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Drebrin 1 Protein (NBP2-38650PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Drebrin 1 Antibody - BSA Free

• D0S117E
• DBN1
• Developmentally-regulated brain protein
• DKFZp434D064
• Drba
• Drebrin 1
• Drebrin A
• Drebrin E
• Drebrin E2
• drebrin
• drebrin-1

Background

Drebrins are actin-binding proteins, that are developmentally regulated in the process of neuronal growth. Three isoforms, E1 and E2 (embryonic) and A (adult) are generated by alternative RNA splicing from a single debrin gene in the chicken brain. The expression pattern of each isoform is regulated spatially and temporally in the developing brain. It has been suggested that debrin is one of the intracellular regulators of the neuronal morphogenesis (4). Debrin has also been detected in other kinds of non-neuronal human and bovine tissue but its exact role is unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DBN1
• Uniprot:
  • Q16643(Human)