DRB1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DRB1 Antibody [NBP1-87966] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DRB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VDSLDEPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDKHTKESKGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEELTRIFVMIPKSYTEE
Predicted Species
Mouse (96%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM45
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF,Fixation Permeabilization: PFA/Triton X-100
Control Peptide
DRB1 Protein (NBP1-87966PEP)
Publications
Read Publication using NBP1-87966.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DRB1 Antibody

  • developmentally regulated RNA-binding protein 1
  • Developmentally-regulated RNA-binding protein 1
  • DRB1FLJ44612
  • DRBP1
  • MGC42237
  • putative RNA binding protein RB-1
  • RB-1
  • RNA binding motif protein 45
  • RNA-binding motif protein 45
  • RNA-binding protein 45

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DRB1 Antibody (NBP1-87966)(1)

Reviews for DRB1 Antibody (NBP1-87966) (0)

There are no reviews for DRB1 Antibody (NBP1-87966). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DRB1 Antibody (NBP1-87966) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DRB1 Products

Array NBP1-87966

Research Areas for DRB1 Antibody (NBP1-87966)

Find related products by research area.

Blogs on DRB1

There are no specific blogs for DRB1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DRB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM45