DRB1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DRB1 Antibody [NBP1-87966] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: DRB1 Antibody [NBP1-87966] - Staining of human lateral ventricle shows strong cytoplasmic positivity in granular pattern in neuronal and glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DRB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VDSLDEPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDKHTKESKGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEELTRIFVMIPKSYTEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM45
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Control Peptide
DRB1 Protein (NBP1-87966PEP)
Publications
Read Publication using NBP1-87966.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DRB1 Antibody

  • developmentally regulated RNA-binding protein 1
  • Developmentally-regulated RNA-binding protein 1
  • DRB1FLJ44612
  • DRBP1
  • MGC42237
  • putative RNA binding protein RB-1
  • RB-1
  • RNA binding motif protein 45
  • RNA-binding motif protein 45
  • RNA-binding protein 45

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
H00003125-B02P
Species: Hu
Applications: WB, Flow
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
AF347
Species: Hu
Applications: WB, IHC, Neut
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-84549
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14984
Species: Hu
Applications: WB, IHC, IHC-P
H00001810-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for DRB1 Antibody (NBP1-87966)(1)

Reviews for DRB1 Antibody (NBP1-87966) (0)

There are no reviews for DRB1 Antibody (NBP1-87966). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DRB1 Antibody (NBP1-87966) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DRB1 Products

DRB1 NBP1-87966

Bioinformatics Tool for DRB1 Antibody (NBP1-87966)

Discover related pathways, diseases and genes to DRB1 Antibody (NBP1-87966). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DRB1 Antibody (NBP1-87966)

Discover more about diseases related to DRB1 Antibody (NBP1-87966).
 

Pathways for DRB1 Antibody (NBP1-87966)

View related products by pathway.

Blogs on DRB1

There are no specific blogs for DRB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DRB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM45