DPYS Antibody

Images

 
Western Blot: DPYS Antibody [NBP1-55122] - Transfected 293T cell lysate, concentration 1.25ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DPYS Antibody Summary

Immunogen
Synthetic peptides corresponding to DPYS(dihydropyrimidinase) The peptide sequence was selected from the middle region of DPYS. Peptide sequence LRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPYS
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DPYS and was validated on Western blot.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DPYS Antibody

  • DHPasehydantoinase
  • DHPHydantoinase
  • dihydropyrimidinase
  • Dihydropyrimidine amidohydrolase
  • EC 3.5.2.2

Background

Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001806-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB300-542
Species: Hu, Mu, Rt, GP, Rb
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
H00051733-M09
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-82268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP1-85447
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
MAB5175
Species: Mu
Applications: WB, IHC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85448
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8038
Species: Hu, Mu, Rt
Applications: WB
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-76652
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for DPYS Antibody (NBP1-55122) (0)

There are no publications for DPYS Antibody (NBP1-55122).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPYS Antibody (NBP1-55122) (0)

There are no reviews for DPYS Antibody (NBP1-55122). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DPYS Antibody (NBP1-55122) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPYS Products

Bioinformatics Tool for DPYS Antibody (NBP1-55122)

Discover related pathways, diseases and genes to DPYS Antibody (NBP1-55122). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPYS Antibody (NBP1-55122)

Discover more about diseases related to DPYS Antibody (NBP1-55122).
 

Pathways for DPYS Antibody (NBP1-55122)

View related products by pathway.

PTMs for DPYS Antibody (NBP1-55122)

Learn more about PTMs related to DPYS Antibody (NBP1-55122).

Blogs on DPYS

There are no specific blogs for DPYS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPYS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPYS
Uniprot