DPPII/QPP/DPP7 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DPPII/QPP/DPP7 Antibody [NBP1-84986] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus & vesicles.

Immunohistochemistry-Paraffin: DPPII/QPP/DPP7 Antibody [NBP1-84986] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DPPII/QPP/DPP7 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MFARNAFTVLAMMDYPYPTDFLGPLPANPVKVGCDRLLSEAQRITGLRALAGLVYNASGSEHCYDIYRLYH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPP7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DPPII/QPP/DPP7 Protein (NBP1-84986PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (83%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DPPII/QPP/DPP7 Antibody - BSA Free

• carboxytripeptidase
• Dipeptidyl aminopeptidase II
• dipeptidyl arylamidase II
• dipeptidyl peptidase 2
• Dipeptidyl peptidase 7
• Dipeptidyl peptidase II
• dipeptidylpeptidase 7
• dipeptidyl-peptidase 7
• dipeptidyl-peptidase II
• DPP II
• DPP2
• DPP7
• DPPII
• EC 3.4.14.2
• QPP
• Quiescent cell proline dipeptidase

Background

DPP2 is encoded by this gene is a post-proline cleaving aminopeptidase expressed in quiescent lymphocytes. The resting lymphocytes are maintained through suppression of apoptosis, a state which is disrupted by inhibition of this novel serine protease. The enzyme has strong sequence homology with prolylcarboxypeptidase and is active at both acidic and neutral pH.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DPP7