DPPII/QPP/DPP7 Antibody

Images

 
Western Blot: DPPII/QPP/DPP7 Antibody [NBP1-84986] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: DPPII/QPP/DPP7 Antibody [NBP1-84986] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus & vesicles.
Immunohistochemistry-Paraffin: DPPII/QPP/DPP7 Antibody [NBP1-84986] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Western Blot: DPPII/QPP/DPP7 Antibody [NBP1-84986] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DPPII/QPP/DPP7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MFARNAFTVLAMMDYPYPTDFLGPLPANPVKVGCDRLLSEAQRITGLRALAGLVYNASGSEHCYDIYRLYH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPP7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DPPII/QPP/DPP7 Protein (NBP1-84986PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DPPII/QPP/DPP7 Antibody

  • carboxytripeptidase
  • Dipeptidyl aminopeptidase II
  • dipeptidyl arylamidase II
  • dipeptidyl peptidase 2
  • Dipeptidyl peptidase 7
  • Dipeptidyl peptidase II
  • dipeptidylpeptidase 7
  • dipeptidyl-peptidase 7
  • dipeptidyl-peptidase II
  • DPP II
  • DPP2
  • DPP7
  • DPPII
  • EC 3.4.14.2
  • QPP
  • Quiescent cell proline dipeptidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-84993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002191-M01
Species: Hu
Applications: WB, ELISA, IP
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-01521
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
NB100-1885
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91685
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP1-84986
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DPPII/QPP/DPP7 Antibody (NBP1-84986) (0)

There are no publications for DPPII/QPP/DPP7 Antibody (NBP1-84986).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPPII/QPP/DPP7 Antibody (NBP1-84986) (0)

There are no reviews for DPPII/QPP/DPP7 Antibody (NBP1-84986). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DPPII/QPP/DPP7 Antibody (NBP1-84986) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPPII/QPP/DPP7 Products

Bioinformatics Tool for DPPII/QPP/DPP7 Antibody (NBP1-84986)

Discover related pathways, diseases and genes to DPPII/QPP/DPP7 Antibody (NBP1-84986). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPPII/QPP/DPP7 Antibody (NBP1-84986)

Discover more about diseases related to DPPII/QPP/DPP7 Antibody (NBP1-84986).
 

Pathways for DPPII/QPP/DPP7 Antibody (NBP1-84986)

View related products by pathway.

PTMs for DPPII/QPP/DPP7 Antibody (NBP1-84986)

Learn more about PTMs related to DPPII/QPP/DPP7 Antibody (NBP1-84986).
 

Research Areas for DPPII/QPP/DPP7 Antibody (NBP1-84986)

Find related products by research area.

Blogs on DPPII/QPP/DPP7

There are no specific blogs for DPPII/QPP/DPP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPPII/QPP/DPP7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPP7
Entrez