DPM2 Antibody

Images

 
Western Blot: DPM2 Antibody [NBP2-84818] - Host: Rabbit. Target Name: DPM2. Sample Tissue: Human HepG2 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DPM2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DPM2. Peptide sequence: DSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFISYVMLKTKRVTKKAQ The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
DPM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DPM2 Antibody

  • dolichol phosphate-mannose biosynthesis regulatory protein
  • dolichol phosphate-mannose synthase 2
  • dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
  • FLJ80013
  • MGC111193
  • MGC21559

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05034
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-81216
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-84294
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-83342
Species: Hu
Applications: IHC, IHC-P, WB
NB500-330
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr, IHC-P, IP
H00009091-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-86283
Species: Hu
Applications: IHC, IHC-P, WB
AF3059
Species: Mu
Applications: ICC, Simple Western, WB
259-HE/CF
Species: Hu
Applications: BA
NBP2-13760
Species: Hu
Applications: IHC, IHC-P
AF3688
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
NBP2-62211
Species: Hu
Applications: Flow-IC, Flow, WB
NB100-2244
Species: Hu
Applications: IHC, IHC-P, IP, WB
H00009649-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-79280
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-84818
Species: Hu
Applications: WB

Publications for DPM2 Antibody (NBP2-84818) (0)

There are no publications for DPM2 Antibody (NBP2-84818).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPM2 Antibody (NBP2-84818) (0)

There are no reviews for DPM2 Antibody (NBP2-84818). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DPM2 Antibody (NBP2-84818) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPM2 Products

Bioinformatics Tool for DPM2 Antibody (NBP2-84818)

Discover related pathways, diseases and genes to DPM2 Antibody (NBP2-84818). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPM2 Antibody (NBP2-84818)

Discover more about diseases related to DPM2 Antibody (NBP2-84818).
 

Pathways for DPM2 Antibody (NBP2-84818)

View related products by pathway.

PTMs for DPM2 Antibody (NBP2-84818)

Learn more about PTMs related to DPM2 Antibody (NBP2-84818).

Blogs on DPM2

There are no specific blogs for DPM2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPM2