Home » DPH5 » DPH5 Antibodies » DPH5 Antibody

DPH5 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: DPH5 Antibody [NBP2-76567] - Staining of human cell line RH-30 shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: DPH5 Antibody [NBP2-76567] - Staining of human cell line RH-30 shows localization to the Golgi apparatus. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

DPH5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMS
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPH5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DPH5 Antibody

  • CGI-30
  • Diphthamide biosynthesis methyltransferase
  • diphthine synthase
  • DPH5 homolog (S. cerevisiae)
  • EC 2.1.1.98
  • HSPC143
  • MGC61450
  • NPD015
  • protein x 0011

Background

DPH5 encodes a component of the diphthamide synthesis pathway. Diphthamide is a post-translationally modified histidine residue found only on translation elongation factor 2. It is conserved from archaebacteria to humans, and is targeted by diphtheria toxin and Pseudomonas exotoxin A to halt cellular protein synthesis. The yeast and Chinese hamster homologs of this protein catalyze the trimethylation of the histidine residue on elongation factor 2, resulting in a diphthine moiety that is subsequently amidated to yield diphthamide. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

eEF-2 Antibody
(4E2Z5)
NBP3-16866
Immunohistochemistry-Paraffin: eEF-2 Antibody (4E2Z5) [NBP3-16866] - Immunohistochemistry of paraffin-embedded human appendix using eEF-2 Rabbit mAb (NBP3-16866) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunocytochemistry/Immunofluorescence: eEF-2 Antibody (4E2Z5) [NBP3-16866] - Immunofluorescence analysis of C6 cells using eEF-2 Rabbit mAb (NBP3-16866) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: eEF-2 Antibody (4E2Z5) [NBP3-16866] - Immunofluorescence analysis of NIH-3T3 cells using eEF-2 Rabbit mAb (NBP3-16866) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DPH3 Antibody
NBP1-84276
Immunocytochemistry/Immunofluorescence: DPH3 Antibody [NBP1-84276] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DPH3 Antibody [NBP1-84276] - Staining of human spleen shows distinct cytoplasmic positivity in cells in red pulp.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
OVCA1 Antibody
NBP1-56693
Western Blot: OVCA1 Antibody [NBP1-56693] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Immunocytochemistry/Immunofluorescence: OVCA1 Antibody [NBP1-56693] - Formalin Fixed Paraffin; Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm (perinuclear) but not nuclear in hepatocytes, strong signal, low tissue distribution; Primary Antibody Concentration: 1:100
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DPH2 Antibody
(OTI4E7)
NBP2-03732
Flow Cytometry: DPH2 Antibody (4E7) [NBP2-03732] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-DPH2 antibody, and then analyzed by flow cytometry.
Western Blot: DPH2 Antibody (4E7) [NBP2-03732] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DPH2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DPH2.
Immunohistochemistry-Paraffin: DPH2 Antibody (4E7) [NBP2-03732] - Staining of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-DPH2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
TRP2 Antibody
NBP1-86893
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86893] - Analysis in human skin and lymph node tissues. Corresponding DCT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86893] - Staining of human skin shows cytoplasmic positivity in squamous epithelial cells.
Western Blot: TRP2 Antibody [NBP1-86893] - Analysis in human cell line SK-MEL-30 and human cell line U-2 OS.
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DPH4 Antibody
NBP1-87969
Western Blot: DPH4 Antibody [NBP1-87969] - Analysis in control (vector only transfected HEK293T lysate) and DNAJC24 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: DPH4 Antibody [NBP1-87969] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: DPH4 Antibody [NBP1-87969] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Dystonin Antibody
NBP1-89946
Immunocytochemistry/Immunofluorescence: Dystonin Antibody [NBP1-89946] - Staining of human cell line A-431 shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Dystonin Antibody [NBP1-89946] - Staining of human cerebellum shows weak to moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: Dystonin Antibody [NBP1-89946] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DNAJC1 Antibody
NBP1-32448
Immunocytochemistry/Immunofluorescence: DNAJC1 Antibody [NBP1-32448] - Analysis of methanol-fixed HeLa, using antibody at 1:200 dilution.
Western Blot: DNAJC1 Antibody [NBP1-32448] - Sample(30 ug whole cell lysate)A:Hep G2 7. 5% SDS PAGE, antibody diluted at 1:1000.
Species: Hu
Applications: ICC/IF, WB
ELP2 Antibody
NBP1-83819
Immunohistochemistry-Paraffin: ELP2 Antibody [NBP1-83819] - Staining of human placenta shows distinct cytoplasmic positivity in trophoblasts.
Immunocytochemistry/Immunofluorescence: ELP2 Antibody [NBP1-83819] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Peripherin 2/PRPH2
Antibody
NBP1-86687
Western Blot: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Analysis in control (vector only transfected HEK293T lysate) and PRPH2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Staining of human endometrium shows no positivity in glandular cells as expected.
Species: Hu
Applications: IHC, IHC-P, WB
TTF2 Antibody (1E8)
H00008458-M06
Immunocytochemistry/Immunofluorescence: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of monoclonal antibody to TTF2 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of TTF2 expression in PC-12 (Cat # L012V1).
Western Blot: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of TTF2 expression in Hela S3 NE (Cat # L013V3).
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
DHPS Antibody
NBP1-82648
Immunocytochemistry/Immunofluorescence: DHPS Antibody [NBP1-82648] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.
Western Blot: DHPS Antibody [NBP1-82648] - Analysis in control (vector only transfected HEK293T lysate) and DHPS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DNAJB13 Antibody
NBP2-30620
Immunohistochemistry-Paraffin: DNAJB13 Antibody [NBP2-30620] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: DNAJB13 Antibody [NBP2-30620] - Staining of human tonsil shows low expression as expected.
Western Blot: DNAJB13 Antibody [NBP2-30620] - Analysis in control (vector only transfected HEK293T lysate) and DNAJB13 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Species: Hu
Applications: IHC, IHC-P, WB
DERP6 Antibody
NBP1-85250
Western Blot: DERP6 Antibody [NBP1-85250] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: DERP6 Antibody [NBP1-85250] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Immunocytochemistry/Immunofluorescence: DERP6 Antibody [NBP1-85250] - Staining of human cell line U-2 OS shows positivity in cytoplasm. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Cytokeratin, pan
Antibody (AE-1/AE-3)
NBP2-29429
Dual RNAscope ISH-IHC: Cytokeratin, pan Antibody (AE-1/AE-3) [NBP2-29429] - FFPE tissue sections of human metastatic tonsil were probed for Pan Cytokeratin mRNA (ACD RNAScope probe, catalog # 310221; Fast Red chromogen, ACD catalog # 322500). Adjacent tissue section was processes for IHC using mouse monoclonal antibody (Novus catalog # NBP2-29429) at 0.3 ug/mL for 1 hour at room temperature followed by incubation with the anti-mouse IgG VisUCyte HRP Polymer Antibody (Novus Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue).
CyTOF-reported: Cytokeratin, pan Antibody (AE-1/AE-3) [NBP2-29429] - Human fibroblasts. Blue: fibroblasts. Red: fibroblast + cytokeratin transfection. CyTOF image submitted by a verified customer review.
Flow Cytometry: Cytokeratin, pan Antibody (AE-1/AE-3) [NBP2-29429] - Human Pan-Cytokeratins on HeLa Cells. Black: Cells alone; Green: Isotype Control; Red: PE-labeled Pan-Cytokeratin Monoclonal Antibody (AE-1/AE-3)
(1 Review)
(39 Publications)
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single-Cell Western, WB
Dehydrodolichyl
Diphosphate Synthase ...
NBP1-87964
Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-87964] - Staining of human Epididymis shows strong membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-87964] - Staining of human Kidney shows strong membranous and cytoplasmic positivity in cells in tubules and glomeruli.
Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-87964] - Staining of human Rectum shows strong membranous and cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Coagulation Factor
II/Thrombin Antibody
NBP1-58268
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue, 5.0ug/ml.
Western Blot: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - 721_B tissue lysate at a concentration of 1ug/ml.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
CSHL1 Antibody
NBP2-98959
Immunohistochemistry-Paraffin: CSHL1 Antibody [NBP2-98959] - Immunochemical staining of human CSHL1 in human placenta with rabbit polyclonal antibody (1:1000, formalin-fixed paraffin embedded sections).
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, WB
TRAILR2/TNFRSF10B
Antibody
NB100-56618
Immunohistochemistry-Paraffin: TRAILR2/TNFRSF10B Antibody [NB100-56618] - TRAIL R2/TNFRSF10B Antibody [NB100-56618] - Analysis of a formalin fixed paraffin-embedded (FFPE) human brain cerebellum using 1:200 conc. of TRAIL R2/TNFRSF10B antibody on a Bond Rx autostainer (Leica Biosystems). The assay involved 30 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 9.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 15 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Cytoplasmic staining was observed in the Purkinje cell layer.
Immunohistochemistry: TRAILR2/TNFRSF10B Antibody [NB100-56618] - Pharmacodynamic assays for ONC201. IHC analyses of CHOP, TRAILR2/TNFRSF10B, and double-stranded DNA breaks (TUNEL) in baseline and ONC201-treated biopsies for an endometrial cancer patient. The biopsy was done 9.8 months after starting ONC201 treatment (7 days after the most recent ONC201 dose). Image collected and cropped by CiteAb from the following publication (https://jitc.biomedcentral.com/articles/10.1186/s40425-019-0599-8) licensed under a CC-BY licence.
Western Blot: TRAILR2/TNFRSF10B Antibody [NB100-56618] - TRAIL R2/TNFRSF10B Antibody [NB100-56618] - Analysis using the Azide Free version of NB100-56618. Detection of 20 ug of whole cell lysates from HL60 cells with anti-TRAIL-R2 at 5 ug/ml.
(1 Review)
(41 Publications)
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
DPH5 Antibody
NBP2-76567
DPH5 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for DPH5 Antibody (NBP2-76567) (0)

There are no publications for DPH5 Antibody (NBP2-76567).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPH5 Antibody (NBP2-76567) (0)

There are no reviews for DPH5 Antibody (NBP2-76567). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DPH5 Antibody (NBP2-76567) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPH5 Products

Bioinformatics Tool for DPH5 Antibody (NBP2-76567)

Discover related pathways, diseases and genes to DPH5 Antibody (NBP2-76567). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPH5 Antibody (NBP2-76567)

Discover more about diseases related to DPH5 Antibody (NBP2-76567).
 

Pathways for DPH5 Antibody (NBP2-76567)

View related products by pathway.

PTMs for DPH5 Antibody (NBP2-76567)

Learn more about PTMs related to DPH5 Antibody (NBP2-76567).
 

Research Areas for DPH5 Antibody (NBP2-76567)

Find related products by research area.

Blogs on DPH5

There are no specific blogs for DPH5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPH5 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol DPH5