DNAJB13 Antibody

Images

 
Immunohistochemistry: DNAJB13 Antibody [NBP2-30620] - Staining of human bronchus shows strong membranous with additional cytoplasmic positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAJB13 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DVKPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAJB13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DNAJB13 Protein (NBP2-30620PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNAJB13 Antibody

  • DnaJ (Hsp40) homolog, subfamily B, member 13,1700014P03Rik
  • DnaJ (Hsp40) related, subfamily B, member 13
  • dnaJ homolog subfamily B member 13
  • DnaJ-like protein
  • radial spoke 16 homolog A
  • RSPH16A
  • Testis and spermatogenesis cell-related protein 6
  • Testis spermatocyte apoptosis-related gene 6 protein
  • Testis spermatogenesis apoptosis-related gene 3 protein
  • Testis spermatogenesis apoptosis-related gene 6 protein
  • testis spermatogenesis apoptosis-related protein 6
  • TSARG3
  • TSARG5
  • TSARG6FLJ46748

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
MAB7185
Species: Hu
Applications: WB, Simple Western
NBP1-32731
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-85002
Species: Hu
Applications: WB, IHC, IHC-P
AF1543
Species: Hu
Applications: WB, IHC
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-80661
Species: Hu
Applications: IHC, IHC-P
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-81507
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-90096
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12553
Species: Hu
NBP2-15597
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DNAJB13 Antibody (NBP2-30620) (0)

There are no publications for DNAJB13 Antibody (NBP2-30620).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJB13 Antibody (NBP2-30620) (0)

There are no reviews for DNAJB13 Antibody (NBP2-30620). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DNAJB13 Antibody (NBP2-30620) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAJB13 Products

Bioinformatics Tool for DNAJB13 Antibody (NBP2-30620)

Discover related pathways, diseases and genes to DNAJB13 Antibody (NBP2-30620). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJB13 Antibody (NBP2-30620)

Discover more about diseases related to DNAJB13 Antibody (NBP2-30620).
 

Pathways for DNAJB13 Antibody (NBP2-30620)

View related products by pathway.

Research Areas for DNAJB13 Antibody (NBP2-30620)

Find related products by research area.

Blogs on DNAJB13

There are no specific blogs for DNAJB13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJB13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJB13
Uniprot