DELGEF Antibody

Images

 
Western Blot: DELGEF Antibody [NBP1-88025] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-157
Immunohistochemistry-Paraffin: DELGEF Antibody [NBP1-88025] - Staining of human thyroid gland shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DELGEF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GTEANVWAPKPVQALLSSSGLLVGCGAGHSLALCQLPAHPALVQDPKVTYLSPDAIEDTESQKAMDKERNWKERQSETSTQSQSDWSRNG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERGEF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DELGEF Protein (NBP1-88025PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DELGEF Antibody

  • Deafness locus-associated putative guanine nucleotide exchange factor
  • DelGEF
  • DELGEFdeafness locus associated putative guanine nucleotide exchange factor
  • Gnefr
  • Guanine nucleotide exchange factor-related protein
  • secretion regulating guanine nucleotide exchange factor
  • secretion-regulating guanine nucleotide exchange factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83786
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84276
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-89189
Species: Hu
Applications: IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-59312
Species: Hu
Applications: WB
AF4079
Species: Hu
Applications: WB, ICC
NBP1-88025
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DELGEF Antibody (NBP1-88025) (0)

There are no publications for DELGEF Antibody (NBP1-88025).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DELGEF Antibody (NBP1-88025) (0)

There are no reviews for DELGEF Antibody (NBP1-88025). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DELGEF Antibody (NBP1-88025) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DELGEF Products

Bioinformatics Tool for DELGEF Antibody (NBP1-88025)

Discover related pathways, diseases and genes to DELGEF Antibody (NBP1-88025). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DELGEF

There are no specific blogs for DELGEF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DELGEF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERGEF