Recombinant Human DPF2 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human DPF2 Protein [H00005977-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human DPF2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 56-155 of Human DPF2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: WMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
DPF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DPF2 GST (N-Term) Protein

  • Apoptosis response zinc finger protein
  • D4, zinc and double PHD fingers family 2BAF45D
  • MGC10180
  • Protein requiem
  • REQBRG1-associated factor 45D
  • requiem, apoptosis response zinc finger
  • ubi-d4
  • UBID4requiem, apoptosis response zinc finger gene
  • zinc finger protein ubi-d4

Background

DPF2 - D4, zinc and double PHD fingers family 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13932
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14910
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
NBP3-13283
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00002968-B01P
Species: Hu
Applications: ICC/IF, WB
MAB3468
Species: Hu
Applications: ICC, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
H00002288-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
DCX130
Species: Hu
Applications: ELISA
NB100-56725
Species: Hu, Mu
Applications: Flow-IC, Flow, IHC, IHC-P, IP, WB
NBP1-47254
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87760
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
AF6015
Species: Hu, Mu, Rt
Applications: WB
NBP2-19795
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF5738
Species: Hu
Applications: ICC, KO, WB
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA

Publications for DPF2 Partial Recombinant Protein (H00005977-Q01) (0)

There are no publications for DPF2 Partial Recombinant Protein (H00005977-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPF2 Partial Recombinant Protein (H00005977-Q01) (0)

There are no reviews for DPF2 Partial Recombinant Protein (H00005977-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DPF2 Partial Recombinant Protein (H00005977-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DPF2 Products

Bioinformatics Tool for DPF2 Partial Recombinant Protein (H00005977-Q01)

Discover related pathways, diseases and genes to DPF2 Partial Recombinant Protein (H00005977-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPF2 Partial Recombinant Protein (H00005977-Q01)

Discover more about diseases related to DPF2 Partial Recombinant Protein (H00005977-Q01).
 

Pathways for DPF2 Partial Recombinant Protein (H00005977-Q01)

View related products by pathway.

PTMs for DPF2 Partial Recombinant Protein (H00005977-Q01)

Learn more about PTMs related to DPF2 Partial Recombinant Protein (H00005977-Q01).
 

Research Areas for DPF2 Partial Recombinant Protein (H00005977-Q01)

Find related products by research area.

Blogs on DPF2

There are no specific blogs for DPF2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DPF2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DPF2