Recombinant Human Dopamine D2R/DRD2 Protein

Images

 
There are currently no images for Dopamine D2R/DRD2 Recombinant Protein (H00001813-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AP

Order Details

Recombinant Human Dopamine D2R/DRD2 Protein Summary

Description
An untagged recombinant protein corresponding to the amino acid sequence of (ABM82846.1) for Human Dopamine D2 R/DRD2

Source: Wheat Germ (in vitro) with proprietary liposome technology

Amino Acid Sequence: MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC

Preparation
Method
in vitro wheat germ expression system with proprietary liposome technology
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
DRD2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Immunoaffinity Purification
Theoretical MW
48.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl pH8.0 in 2% glycerol.
Preservative
Glycerol
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Dopamine D2R/DRD2 Protein

  • D(2) dopamine receptor
  • D2DR
  • D2R
  • Dopamine D2 R
  • Dopamine D2 receptor
  • Dopamine D2R
  • dopamine receptor D2 isoform
  • dopamine receptor D2
  • DRD2
  • seven transmembrane helix receptor

Background

The DRD2 Dopamine Receptor is involved in the neuromodulation of appetitive behaviors. DRD2 may be linked to alcoholism and other substance-use disorders. Mutations in DRD2 in mice lead to the suppression of reward behavior with morphine and to the reduction of spontaneous movements, a phenotype resembling Parkinson's disease. Three alternatively spliced isoforms have been identified. DRD2 has been reported to be expressed in various regions of the brain, as well as in aorta, artery, eye, and spinal cord. ESTs have been isolated from normal pituitary and in brain, colon, lung, pancreas, and skeletal muscle cancer libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for Dopamine D2R/DRD2 Recombinant Protein (H00001813-G01) (0)

There are no publications for Dopamine D2R/DRD2 Recombinant Protein (H00001813-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dopamine D2R/DRD2 Recombinant Protein (H00001813-G01) (0)

There are no reviews for Dopamine D2R/DRD2 Recombinant Protein (H00001813-G01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Dopamine D2R/DRD2 Recombinant Protein (H00001813-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dopamine D2R/DRD2 Products

Research Areas for Dopamine D2R/DRD2 Recombinant Protein (H00001813-G01)

Find related products by research area.

Blogs on Dopamine D2R/DRD2

There are no specific blogs for Dopamine D2R/DRD2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Dopamine D2R/DRD2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DRD2