Recombinant Human Dopamine D2R/DRD2 Protein

• Reactivity: Hu
• Applications: AP

Recombinant Human Dopamine D2R/DRD2 Protein Summary

• Description: An untagged recombinant protein corresponding to the amino acid sequence of (ABM82846.1) for Human Dopamine D2 R/DRD2
  
  

  Source: Wheat Germ (in vitro) with proprietary liposome technology

  Amino Acid Sequence: MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC

• Preparation Method: in vitro wheat germ expression system with proprietary liposome technology
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: DRD2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Immunoaffinity Purification
• Theoretical MW: 48.73 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 25 mM Tris-HCl pH8.0 in 2% glycerol.
• Preservative: Glycerol
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Dopamine D2R/DRD2 Protein

• D(2) dopamine receptor
• D2DR
• D2R
• Dopamine D2 R
• Dopamine D2 receptor
• Dopamine D2R
• dopamine receptor D2 isoform
• dopamine receptor D2
• DRD2
• seven transmembrane helix receptor

Background

The DRD2 Dopamine Receptor is involved in the neuromodulation of appetitive behaviors. DRD2 may be linked to alcoholism and other substance-use disorders. Mutations in DRD2 in mice lead to the suppression of reward behavior with morphine and to the reduction of spontaneous movements, a phenotype resembling Parkinson's disease. Three alternatively spliced isoforms have been identified. DRD2 has been reported to be expressed in various regions of the brain, as well as in aorta, artery, eye, and spinal cord. ESTs have been isolated from normal pituitary and in brain, colon, lung, pancreas, and skeletal muscle cancer libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: DRD2