DOC2B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DOC2B Antibody [NBP2-13930] Staining of human cell line U-251 MG shows positivity in cytoskeleton (microtubules).
Immunohistochemistry-Paraffin: DOC2B Antibody [NBP2-13930] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DOC2B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LKKLKPNHTKTFSICLEKQLPVDKTEDKSLEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DOC2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
DOC2B Protein (NBP2-13930PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DOC2B Antibody

  • DOC2BL
  • double C2-like domains, beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7904
Species: Hu, Mu
Applications: WB
AF8064
Species: Hu
Applications: WB, IHC, ICC
MAB6188
Species: Hu
Applications: IHC
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
AF1936
Species: Hu
Applications: WB, IP
AF5659
Species: Hu
Applications: WB
NBP1-69184
Species: Mu, Rt
Applications: WB
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-58497
Species: Hu
Applications: WB, ICC/IF
NBP1-69184
Species: Mu, Rt
Applications: WB
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DOC2B Antibody (NBP2-13930) (0)

There are no publications for DOC2B Antibody (NBP2-13930).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DOC2B Antibody (NBP2-13930) (0)

There are no reviews for DOC2B Antibody (NBP2-13930). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DOC2B Antibody (NBP2-13930) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DOC2B Products

Bioinformatics Tool for DOC2B Antibody (NBP2-13930)

Discover related pathways, diseases and genes to DOC2B Antibody (NBP2-13930). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DOC2B Antibody (NBP2-13930)

Discover more about diseases related to DOC2B Antibody (NBP2-13930).
 

Pathways for DOC2B Antibody (NBP2-13930)

View related products by pathway.

PTMs for DOC2B Antibody (NBP2-13930)

Learn more about PTMs related to DOC2B Antibody (NBP2-13930).
 

Research Areas for DOC2B Antibody (NBP2-13930)

Find related products by research area.

Blogs on DOC2B

There are no specific blogs for DOC2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DOC2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DOC2B