DNER Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptide directed towards the middle region of human DNERThe immunogen for this antibody is DNER. Peptide sequence DACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDP. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DNER |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
1 mg/ml |
| Purity |
Protein A purified |
Alternate Names for DNER Antibody - BSA Free
Background
DNER, also known as Delta and Notch-like epidermal growth factor-related receptor, is a 78.5 kDa, 737 amino acid protein and is involved in activating the NOTCH1 pathway. Current research is being conducted on diseases and disorders such as hepatitis, neuronitis and pathological gambling. The protein interacts with other proteins such as NOTCH1, APH1A, ZNF24, AP1G1, and DTX1 in Notch signaling pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, In vitro
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: CHIP-SEQ, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, IHC
Species: Hu
Applications: WB
Publications for DNER Antibody (NBP1-79415) (0)
There are no publications for DNER Antibody (NBP1-79415).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DNER Antibody (NBP1-79415) (0)
There are no reviews for DNER Antibody (NBP1-79415).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DNER Antibody (NBP1-79415) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DNER Products
Research Areas for DNER Antibody (NBP1-79415)
Find related products by research area.
|
Blogs on DNER