DNASE2B Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human DNASE2B (NP_490649). Peptide sequence QKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESCK |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DNASE2B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
18 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for DNASE2B Antibody - BSA Free
Background
DNASE2B, also known as Deoxyribonuclease-2-beta, consists of a 41.7 kDa and a 17.8 kDa isoform and is utilized in the eye lens, salivary glands, and lungs to hydrolyze DNA in acidic conditions. Diseases and disorder such as cataract, prostatitis, and alcoholism have been researched with the protein. The protein interacts in lysosome pathways with RBL1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu, Pm, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Ba
Applications: ELISA, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ELISA, WB
Species: Mu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: WB
Publications for DNASE2B Antibody (NBP3-10550) (0)
There are no publications for DNASE2B Antibody (NBP3-10550).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DNASE2B Antibody (NBP3-10550) (0)
There are no reviews for DNASE2B Antibody (NBP3-10550).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DNASE2B Antibody (NBP3-10550) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DNASE2B Products
Research Areas for DNASE2B Antibody (NBP3-10550)
Find related products by research area.
|
Blogs on DNASE2B