DNALI1 Antibody

Images

 
Immunohistochemistry-Paraffin: DNALI1 Antibody [NBP1-84222] - Staining of human fallopian tube shows strong membrane and additional cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNALI1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKARLLKVSPQQPGPSGSAPQPPKTKLPSTPCVPDPTKQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNALI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DNALI1 Protein (NBP1-84222PEP)
Publications
Read Publication using NBP1-84222.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24518672)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNALI1 Antibody

  • dJ423B22.5
  • dynein, axonemal, light intermediate chain 1
  • dynein, axonemal, light intermediate polypeptide 1
  • hp28axonemal dynein light intermediate polypeptide 1
  • Inner dynein arm light chain, axonemal
  • inner dynein arm, homolog of clamydomonas
  • P28dJ423B22.5 (axonemal dynein light chain (hp28))

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86784
Species: Hu
Applications: IHC, IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-98493
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-27362
Species: Hu
Applications: WB, IHC, IHC-P, TCS
NBP1-84222
Species: Hu
Applications: IHC, IHC-P

Publications for DNALI1 Antibody (NBP1-84222)(1)

Reviews for DNALI1 Antibody (NBP1-84222) (0)

There are no reviews for DNALI1 Antibody (NBP1-84222). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DNALI1 Antibody (NBP1-84222) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNALI1 Products

Bioinformatics Tool for DNALI1 Antibody (NBP1-84222)

Discover related pathways, diseases and genes to DNALI1 Antibody (NBP1-84222). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNALI1 Antibody (NBP1-84222)

Discover more about diseases related to DNALI1 Antibody (NBP1-84222).

PTMs for DNALI1 Antibody (NBP1-84222)

Learn more about PTMs related to DNALI1 Antibody (NBP1-84222).

Blogs on DNALI1

There are no specific blogs for DNALI1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNALI1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNALI1