DNALI1 Antibody


Western Blot: DNALI1 Antibody [NBP1-56390] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: DNALI1 Antibody [NBP1-56390] - Application: IHCSpecies+tissue/cell type: Human nasal epithelial cells Primary Antibody dilution: 1 : 1000 Secondary Antibody: Goat anti-rabbit Alexa Fluor 546 ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC

Order Details

DNALI1 Antibody Summary

Synthetic peptides corresponding to DNALI1(dynein, axonemal, light intermediate chain 1) The peptide sequence was selected from the N terminal of DNALI1. Peptide sequence MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against DNALI1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DNALI1 Antibody

  • dJ423B22.5
  • dynein, axonemal, light intermediate chain 1
  • dynein, axonemal, light intermediate polypeptide 1
  • hp28axonemal dynein light intermediate polypeptide 1
  • Inner dynein arm light chain, axonemal
  • inner dynein arm, homolog of clamydomonas
  • P28dJ423B22.5 (axonemal dynein light chain (hp28))


DNALI1 is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects. This gene is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Mu
Species: Hu
Applications: WB, IHC, IHC-P, TCS
Species: Hu
Applications: WB, IHC

Publications for DNALI1 Antibody (NBP1-56390) (0)

There are no publications for DNALI1 Antibody (NBP1-56390).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNALI1 Antibody (NBP1-56390) (0)

There are no reviews for DNALI1 Antibody (NBP1-56390). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNALI1 Antibody (NBP1-56390) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DNALI1 Products

Bioinformatics Tool for DNALI1 Antibody (NBP1-56390)

Discover related pathways, diseases and genes to DNALI1 Antibody (NBP1-56390). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNALI1 Antibody (NBP1-56390)

Discover more about diseases related to DNALI1 Antibody (NBP1-56390).

PTMs for DNALI1 Antibody (NBP1-56390)

Learn more about PTMs related to DNALI1 Antibody (NBP1-56390).

Blogs on DNALI1

There are no specific blogs for DNALI1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DNALI1 Antibody and receive a gift card or discount.


Gene Symbol DNALI1