DNAJC28 Antibody

Images

 
Immunohistochemistry-Paraffin: DNAJC28 Antibody [NBP1-88273] - Immunohistochemical staining of human duodenum shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAJC28 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LIQESMAKGDFDNLSGKGKPLKKFSDCSYIDPMTHNLNRILIDNGYQPEWILKQKEISDTIEQLREAILVSRKKLGNPMTPTEKKQWNHVCEQF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAJC28
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DNAJC28 Protein (NBP1-88273PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNAJC28 Antibody

  • DnaJ (Hsp40) homolog, subfamily C, member 28
  • dnaJ homolog subfamily C member 28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01168
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P
NBP2-27398
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-Fr, IHC-P, IP
NB100-56696
Species: Hu
Applications: WB, Flow
NBP1-90488
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56091
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-14106
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-98528
Species: Hu
Applications: WB
NB100-56087
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-80715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81842
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87969
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80857
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02377
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86941
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89366
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56082
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
30230002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for DNAJC28 Antibody (NBP1-88273) (0)

There are no publications for DNAJC28 Antibody (NBP1-88273).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC28 Antibody (NBP1-88273) (0)

There are no reviews for DNAJC28 Antibody (NBP1-88273). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DNAJC28 Antibody (NBP1-88273) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAJC28 Products

Bioinformatics Tool for DNAJC28 Antibody (NBP1-88273)

Discover related pathways, diseases and genes to DNAJC28 Antibody (NBP1-88273). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DNAJC28

There are no specific blogs for DNAJC28, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJC28 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC28