![Western Blot: DNAJC22 Antibody [H00079962-B01P] - Analysis of DNAJC22 expression in transfected 293T cell line by DNAJC22 polyclonal antibody. Lane 1: FLJ13236 transfected lysate(37.51 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/DNAJC22-Antibody-Western-Blot-H00079962-B01P-img0002.jpg "Western Blot: DNAJC22 Antibody [H00079962-B01P] - Analysis of DNAJC22 expression in transfected 293T cell line by DNAJC22 polyclonal antibody. Lane 1: FLJ13236 transfected lysate(37.51 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse DNAJC22 Antibody - Azide and BSA Free (H00079962-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | FLJ13236 (NP_079178.2, 1 a.a. - 341 a.a.) full-length human protein. MAKGLLVTYALWAVGGPAGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWKLPSFVAQANRAQGQRQSPRGVTPPLSPIRFAAQVIVGIYFGLVALISLSSMVNFYIVALPLAVGLGVLLVAAVGNQTSDFKNTLGSAFLTSPIFYGRPIAILPISVAASITAQRHRRYKALVASEPLSVRLYRLGLAYLAFTGPLAYSALCNTAATLSYVAETFGSFLNWFSFFPLLGRLMEFVLLLPYRIWRLLMGETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKPWGSRR |
| Specificity | FLJ13236 - hypothetical protein FLJ13236, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | DNAJC22 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against recombinant protein with GST tag on ELISA and western blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DNAJC22 |
| Entrez |
|
| Uniprot |
|
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A Corin [Biotin]](https://images.novusbio.com/images2/DATA_Corin_DY2209_ELISA_1787.jpg)
![Western Blot Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Western_Blot_6024.jpg)
![Immunocytochemistry Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Immunocytochemistry__Immunofluorescence_23049.jpg)
![Immunohistochemistry Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Immunohistochemistry_7360.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")