DNAJC12 Antibody


Immunohistochemistry-Paraffin: DNAJC12 Antibody [NBP1-83083] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: DNAJC12 Antibody [NBP1-83083] - Staining of human kidney shows strong cytoplasmic and membranous positivity in tubule cells.
Immunohistochemistry: DNAJC12 Antibody [NBP1-83083] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: DNAJC12 Antibody [NBP1-83083] - Staining in human adrenal gland and lymph node tissues using anti-DNAJC12 antibody. Corresponding DNAJC12 RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

DNAJC12 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTSMHWVVRGK
Specificity of human DNAJC12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DNAJC12 Protein (NBP1-83083PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DNAJC12 Antibody

  • DnaJ (Hsp40) homolog, subfamily C, member 12
  • dnaJ homolog subfamily C member 12
  • J domain containing protein 1 (JDP1)
  • J domain protein 1
  • JDP1J domain-containing protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
Species: Ce
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for DNAJC12 Antibody (NBP1-83083) (0)

There are no publications for DNAJC12 Antibody (NBP1-83083).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC12 Antibody (NBP1-83083) (0)

There are no reviews for DNAJC12 Antibody (NBP1-83083). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DNAJC12 Antibody (NBP1-83083) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DNAJC12 Products

Bioinformatics Tool for DNAJC12 Antibody (NBP1-83083)

Discover related pathways, diseases and genes to DNAJC12 Antibody (NBP1-83083). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC12 Antibody (NBP1-83083)

Discover more about diseases related to DNAJC12 Antibody (NBP1-83083).

Pathways for DNAJC12 Antibody (NBP1-83083)

View related products by pathway.

PTMs for DNAJC12 Antibody (NBP1-83083)

Learn more about PTMs related to DNAJC12 Antibody (NBP1-83083).

Blogs on DNAJC12

There are no specific blogs for DNAJC12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DNAJC12 Antibody and receive a gift card or discount.


Gene Symbol DNAJC12