DNAJC12 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit DNAJC12 Antibody - BSA Free (NBP1-83083) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTSMHWVVRGK |
| Predicted Species |
Mouse (90%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DNAJC12 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for DNAJC12 Antibody - BSA Free
Background
The DNAJC12 gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins areassociated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms havebeen identified for this
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, KD, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF (-), IHC, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
Species: Ce
Applications: IHC, IHC-P, IP, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, KD, PLA, WB
Species: Hu
Applications: IHC, IHC-P
Publications for DNAJC12 Antibody (NBP1-83083) (0)
There are no publications for DNAJC12 Antibody (NBP1-83083).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DNAJC12 Antibody (NBP1-83083) (0)
There are no reviews for DNAJC12 Antibody (NBP1-83083).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for DNAJC12 Antibody (NBP1-83083) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DNAJC12 Products
Research Areas for DNAJC12 Antibody (NBP1-83083)
Find related products by research area.
|
Blogs on DNAJC12