DNA polymerase alpha Antibody (3C11)

Images

 
Western Blot: DNA polymerase alpha Antibody (3C11) [H00005422-M01] - POLA monoclonal antibody (M01), clone 3C11 Analysis of POLA expression in Hela S3 NE.
Sandwich ELISA: DNA polymerase alpha Antibody (3C11) [H00005422-M01] - Detection limit for recombinant GST tagged POLA is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DNA polymerase alpha Antibody (3C11) Summary

Immunogen
POLA (NP_058633 1363 a.a. - 1462 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVKS
Specificity
POLA - polymerase (DNA directed), alpha
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
POLA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DNA polymerase alpha Antibody (3C11)

  • DNA polymerase alpha 1 catalytic subunit
  • DNA polymerase alpha catalytic subunit p180
  • DNA polymerase alpha catalytic subunit
  • DNA polymerase alpha p180 subunit
  • EC 2.7.7.7
  • p180
  • POLADKFZp686K1672
  • polymerase (DNA directed), alpha 1
  • polymerase (DNA directed), alpha 1, catalytic subunit
  • polymerase (DNA directed), alpha
  • polymerase (DNA-directed), alpha (70kD)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-38600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-59448
Species: Hu
Applications: WB
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-57614
Species: Hu
Applications: ICC/IF
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NB200-351
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-24566
Species: Hu
Applications: WB, IHC-P
7559-ST
Species: Hu
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for DNA polymerase alpha Antibody (H00005422-M01) (0)

There are no publications for DNA polymerase alpha Antibody (H00005422-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA polymerase alpha Antibody (H00005422-M01) (0)

There are no reviews for DNA polymerase alpha Antibody (H00005422-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNA polymerase alpha Antibody (H00005422-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNA polymerase alpha Products

Bioinformatics Tool for DNA polymerase alpha Antibody (H00005422-M01)

Discover related pathways, diseases and genes to DNA polymerase alpha Antibody (H00005422-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA polymerase alpha Antibody (H00005422-M01)

Discover more about diseases related to DNA polymerase alpha Antibody (H00005422-M01).
 

Pathways for DNA polymerase alpha Antibody (H00005422-M01)

View related products by pathway.

PTMs for DNA polymerase alpha Antibody (H00005422-M01)

Learn more about PTMs related to DNA polymerase alpha Antibody (H00005422-M01).

Blogs on DNA polymerase alpha

There are no specific blogs for DNA polymerase alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA polymerase alpha Antibody (3C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol POLA1
Entrez
OMIM
Uniprot