DNA polymerase alpha Antibody (3C11) Summary
Immunogen |
POLA (NP_058633, 1363 a.a. ~ 1462 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVKS |
Specificity |
POLA - polymerase (DNA directed), alpha |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
POLA1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for DNA polymerase alpha Antibody (3C11)
Background
DNA polymerase alpha plays an essential role in the initiation of DNA replication. During the S phase of the cell cycle, the DNA polymerase alpha complex (composed of a catalytic subunit POLA1/p180, a regulatory subunit POLA2/p70 and two primase subunits PRIM1/p49 and PRIM2/p
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Ha, Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, ELISA, S-ELISA
Publications for DNA polymerase alpha Antibody (H00005422-M01) (0)
There are no publications for DNA polymerase alpha Antibody (H00005422-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DNA polymerase alpha Antibody (H00005422-M01) (0)
There are no reviews for DNA polymerase alpha Antibody (H00005422-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DNA polymerase alpha Antibody (H00005422-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DNA polymerase alpha Products
Bioinformatics Tool for DNA polymerase alpha Antibody (H00005422-M01)
Discover related pathways, diseases and genes to DNA polymerase alpha Antibody (H00005422-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for DNA polymerase alpha Antibody (H00005422-M01)
Discover more about diseases related to DNA polymerase alpha Antibody (H00005422-M01).
| | Pathways for DNA polymerase alpha Antibody (H00005422-M01)
View related products by pathway.
|
PTMs for DNA polymerase alpha Antibody (H00005422-M01)
Learn more about PTMs related to DNA polymerase alpha Antibody (H00005422-M01).
|
Blogs on DNA polymerase alpha