Home » DNA polymerase alpha » DNA polymerase alpha Antibodies » DNA polymerase alpha Antibody (3C11)

DNA polymerase alpha Antibody (3C11)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: DNA polymerase alpha Antibody (3C11) [H00005422-M01] - POLA monoclonal antibody (M01), clone 3C11 Analysis of POLA expression in Hela S3 NE.
Western Blot: DNA polymerase alpha Antibody (3C11) [H00005422-M01] - POLA monoclonal antibody (M01), clone 3C11 Analysis of POLA expression in Hela S3 NE.
Sandwich ELISA: DNA polymerase alpha Antibody (3C11) [H00005422-M01] - Detection limit for recombinant GST tagged POLA is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

DNA polymerase alpha Antibody (3C11) Summary

Immunogen
POLA (NP_058633, 1363 a.a. ~ 1462 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVKS
Specificity
POLA - polymerase (DNA directed), alpha
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
POLA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DNA polymerase alpha Antibody (3C11)

  • DNA polymerase alpha 1 catalytic subunit
  • DNA polymerase alpha catalytic subunit p180
  • DNA polymerase alpha catalytic subunit
  • DNA polymerase alpha p180 subunit
  • EC 2.7.7.7
  • p180
  • POLADKFZp686K1672
  • polymerase (DNA directed), alpha 1
  • polymerase (DNA directed), alpha 1, catalytic subunit
  • polymerase (DNA directed), alpha
  • polymerase (DNA-directed), alpha (70kD)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Rad51 Antibody
(14B4)
NB100-148
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouset IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouset IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
(5 Reviews)
(57 Publications)
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
DNA Polymerase
beta Antibody
NBP2-38600
Immunocytochemistry/Immunofluorescence: DNA Polymerase beta Antibody [NBP2-38600] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody [NBP2-38600] - Staining in human testis and liver tissues using anti-POLB antibody. Corresponding POLB RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody [NBP2-38600] - Staining of human liver shows low expression as expected.
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Annexin A6 Antibody
NBP1-90149
Western Blot: Annexin A6 Antibody [NBP1-90149] - Analysis in human cell lines SK-MEL-30 and A-431 using anti-ANXA6 antibody. Corresponding ANXA6 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Immunohistochemistry-Paraffin: Annexin A6 Antibody [NBP1-90149] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Annexin A6 Antibody [NBP1-90149] - Staining of human pancreas shows strong membranous positivity in islets of Langerhans.
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded breast tissue using anti-PMEL17/SILV mouse monoclonal antibody.
(1 Review)
Species: Ca, Hu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
POLG2 Antibody
NBP2-94064
Immunocytochemistry/Immunofluorescence: POLG2 Antibody [NBP2-94064] - Analysis of MCF7 cells using POLG2 . Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: POLG2 Antibody [NBP2-94064] - Human stomach using POLG2 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: POLG2 Antibody [NBP2-94064] - Mouse kidney using POLG2 antibody at dilution of 1:100 (40x lens).
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CD45 Antibody
(30-F11) - BSA Free
NB100-77417
Immunohistochemistry-Paraffin: CD45 Antibody (30-F11) [NB100-77417] - Staining of a FFPE mouse liver tissue section using 1:100 dilution of CD45 antibody (30-F11) [NB100-77417]. Signal was detected using AF488 conjugated donkey anti-rat secondary antibody at 1:500 dilution. IHC-P image submitted by a verified customer review.
Immunohistochemistry: CD45 Antibody (30-F11) [NB100-77417] - Severe apoptosis and pathology in the orally infected heart. Experimental design is as outlined in Fig. 1B. Heart sections from moribund mice were examined with H&E, and immunohistochemistry staining for pan-leukocyte infiltration using an anti-CD45 antibody. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-47455-3), licensed under a CC-BY licence.
Immunohistochemistry: CD45 Antibody (30-F11) [NB100-77417] - Severe apoptosis and pathology in the orally infected heart. Experimental design is as outlined in Fig. 1B. Heart sections from moribund mice were examined with H&E, and immunohistochemistry staining for pan-leukocyte infiltration using an anti-CD45 antibody. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-47455-3), licensed under a CC-BY licence.
(5 Reviews)
(37 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, WB
B3GALNT1 Antibody
NBP2-92677
Western Blot: B3GALNT1 Antibody [NBP2-92677] - Analysis of extracts of various cell lines, using B3GALNT1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1s.
Species: Hu, Mu, Rt
Applications: WB
RPLP1 Antibody
NBP1-81293
Immunohistochemistry-Paraffin: RPLP1 Antibody [NBP1-81293] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: RPLP1 Antibody [NBP1-81293] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: RPLP1 Antibody [NBP1-81293] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NUCKS1 Antibody
NB100-74635
Immunohistochemistry-Paraffin: NUCKS1 Antibody [NB100-74635] - Detection of human NUCKS by immunohistochemistry. Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- NUCKS (NB100-74635). Detection: DAB
Immunoprecipitation: NUCKS1 Antibody [NB100-74635] - Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: NUCKS1 antibody NB100-74635 used for IP at 3 ug per reaction. NUCKS was also immunoprecipitated by NUCKS1 antibody NB100-74634. For blotting immunoprecipitated NUCKS, NB100-74635 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Protamine 1
Antibody
NBP2-30949
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining in human testis and endometrium tissues.. Corresponding PRM1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Perforin Antibody
(CB5.4) - BSA Free
NBP1-97512
Western Blot: Perforin Antibody (CB5.4) [NBP1-97512] - Detection of perforin in the mouse T cell clone B6.1. (lane 1). Absence of perforin in the mouse fibroblast cell line NIH.3T3 (lane 2). The protein migrates as a 66 kDa species. Method: Cell extracts from the T cell clone B6.1 (2x10^6) were resolved by SDS-PAGE under reducing conditions, transferred to nitrocellulose and probed with the CB5.4 antibody at 1 ug/ml. Proteins were visualized using a peroxidase-conjugated antibody to rat IgG and a chemiluminescence detection system.
(6 Publications)
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CD77 Synthase
Antibody
NBP1-90824
Immunocytochemistry/Immunofluorescence: CD77 Synthase Antibody [NBP1-90824] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.
Western Blot: CD77 Synthase Antibody [NBP1-90824] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402588)
Species: Hu
Applications: ICC/IF, WB
POLD3 Antibody
(3E2)
H00010714-M01
ELISA: POLD3 Antibody (3E2) [H00010714-M01] - Detection limit for recombinant GST tagged POLD3 is approximately 0.03ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: POLD3 Antibody (3E2) [H00010714-M01] - Analysis of monoclonal antibody to POLD3 on HeLa cell . Antibody concentration 10 ug/ml.
(6 Publications)
Species: Hu
Applications: ELISA, ICC/IF, WB
SAM68 Antibody
NBP1-19151
Immunohistochemistry-Paraffin: SAM68 Antibody [NBP1-19151] - Section of human prostate carcinoma. Antibody: Affinity purified rabbit anti- SAM68 used at a dilution of 1:1,000 (0.2 ug/ml). Detection: DAB
Western Blot: SAM68 Antibody [NBP1-19151] - Whole cell lysate from HeLa cells. SAM68 was also immunoprecipitated by rabbit anti-SAM68 antibodies NBP1-19152 and NBP1-19153.
(1 Review)
(2 Publications)
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC, IHC-P, IP, WB
DDX5 Antibody
NB200-351
Immunoprecipitation: DDX5 Antibody [NB200-351] - Detection of human DDX5 by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-DDX5 antibody NB200-351 (lot NB200-351-2) used for IP at 6 ug per reaction. DDX5 was also immunoprecipitated by a previous lot of this antibody (lot NB200-351-1) and another rabbit anti-DDX5 antibody. For blotting immunoprecipitated DDX5, NB200-351 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
Immunohistochemistry: DDX5 Antibody [NB200-351] - Detection of mouse DDX5 by immunohistochemistry. Sample: FFPE section of mouse skin. Antibody: Affinity purified rabbit anti-DDX5 NB200-351 used at a dilution of 1:1000 (0.2ug/ml). Detection: DAB
Immunohistochemistry: DDX5 Antibody [NB200-351] - Detection of human DDX5 by immunohistochemistry. Sample: FFPE section of human prostate carcinoma. Antibody: Affinity purified rabbit anti-DDX5 NB200-351 used at a dilution of 1:1000 (0.2ug/ml). Detection: DAB
(1 Review)
(5 Publications)
Species: Ha, Hu, Mu
Applications: IHC, IHC-P, IP, WB
MUC13 Antibody -
BSA Free
NBP2-24566
Western Blot: MUC13 Antibody [NBP2-24566] - Total protein from human, HeLa, A549, Hek293 and HepG2 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-MUC13 in blocking buffer and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Paraffin: MUC13 Antibody [NBP2-24566] - Analysis of Mucin 13 in formalin-fixed, paraffin-embedded human heart tissue using an isotype control (top left) and NBP2-24566 (bottom left, right) at 5 ug/ml.
Western Blot: MUC13 Antibody [NBP2-24566] - Analysis of Mucin 13 in human kidney lysate in the 1) absence and 2) presence of immunizing peptide using this antibody. 25 ug/ml.
Species: Hu
Applications: IHC, IHC-P, WB
SECTM1
[Unconjugated]
7559-ST
SECTM1 [Unconjugated]
Species: Hu
Applications: BA
TNF RI/TNFRSF1A
[HRP]
DRT100
(2 Reviews)
(78 Publications)
Species: Hu
Applications: ELISA
Thromboxane
synthase Antibody (OT
NBP2-02710
Flow Cytometry: Thromboxane synthase Antibody (2C1) [NBP2-02710] - Analysis of Hela cells, using anti-Thromboxane synthase antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Thromboxane synthase Antibody (2C1) [NBP2-02710] - Analysis of Jurkat cells, using anti-Thromboxane synthase antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Thromboxane synthase Antibody (2C1) [NBP2-02710] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Thromboxane synthase antibody, and then analyzed by flow cytometry.
(1 Publication)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DNA polymerase
alpha Antibody (3C11)
H00005422-M01
DNA polymerase alpha Antibody (3C11)
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for DNA polymerase alpha Antibody (H00005422-M01) (0)

There are no publications for DNA polymerase alpha Antibody (H00005422-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA polymerase alpha Antibody (H00005422-M01) (0)

There are no reviews for DNA polymerase alpha Antibody (H00005422-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNA polymerase alpha Antibody (H00005422-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNA polymerase alpha Products

Bioinformatics Tool for DNA polymerase alpha Antibody (H00005422-M01)

Discover related pathways, diseases and genes to DNA polymerase alpha Antibody (H00005422-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA polymerase alpha Antibody (H00005422-M01)

Discover more about diseases related to DNA polymerase alpha Antibody (H00005422-M01).
 

Pathways for DNA polymerase alpha Antibody (H00005422-M01)

View related products by pathway.

PTMs for DNA polymerase alpha Antibody (H00005422-M01)

Learn more about PTMs related to DNA polymerase alpha Antibody (H00005422-M01).

Blogs on DNA polymerase alpha

There are no specific blogs for DNA polymerase alpha, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA polymerase alpha Antibody (3C11) and receive a gift card or discount.


Bioinformatics

Gene Symbol POLA1
Entrez
OMIM
Uniprot