Recombinant Human DNA-PKcs Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DNA-PKcs Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 4019-4128 of Human PRKDC partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGREPWM

Protein/Peptide Type
Partial Recombinant Protein
Gene
PRKDC

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00005591-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DNA-PKcs Protein

  • DNA-dependent protein kinase catalytic subunit-like
  • DNA-dependent protein kinase
  • DNA-PK catalytic subunit
  • DNAPK
  • DNAPKcs
  • DNA-PKcs
  • DNPK1
  • EC 2.7.11.1
  • HYRC
  • HYRC1
  • p350
  • p460
  • PRKDC
  • XRCC7

Background

PRKDC - protein kinase, DNA-activated, catalytic polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37583
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-1915
Species: Hu, Mu, Rt, Ha, Pm, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-48053
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-183
Species: Hu
Applications: WB
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for DNA-PKcs Partial Recombinant Protein (H00005591-Q01)(1)

Reviews for DNA-PKcs Partial Recombinant Protein (H00005591-Q01) (0)

There are no reviews for DNA-PKcs Partial Recombinant Protein (H00005591-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNA-PKcs Partial Recombinant Protein (H00005591-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNA-PKcs Products

Bioinformatics Tool for DNA-PKcs Partial Recombinant Protein (H00005591-Q01)

Discover related pathways, diseases and genes to DNA-PKcs Partial Recombinant Protein (H00005591-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA-PKcs Partial Recombinant Protein (H00005591-Q01)

Discover more about diseases related to DNA-PKcs Partial Recombinant Protein (H00005591-Q01).
 

Pathways for DNA-PKcs Partial Recombinant Protein (H00005591-Q01)

View related products by pathway.

PTMs for DNA-PKcs Partial Recombinant Protein (H00005591-Q01)

Learn more about PTMs related to DNA-PKcs Partial Recombinant Protein (H00005591-Q01).
 

Research Areas for DNA-PKcs Partial Recombinant Protein (H00005591-Q01)

Find related products by research area.

Blogs on DNA-PKcs

There are no specific blogs for DNA-PKcs, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Nbs1 Antibody
NB100-143
Mre11 Antibody
NB100-142

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DNA-PKcs Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKDC
Entrez