We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human DNA Ligase III GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related DNA Ligase III Peptides and Proteins

Order Details


    • Catalog Number
      H00003980-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human DNA Ligase III GST (N-Term) Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 299 of Human LIG3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSLAFKIFFPQTLRALSRKELCLFRKHHWRDVRQFSQWSETDLLHGHPLFLRRKPVLSFQGSHLRSRATYLVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIGKVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQHIADLSSKAAGTPKKKAVVQAKLTTTGQVTSPVKGASFVTSTNPRKFSGFSAKPNNSGEAPSSPTPKRSLSSSKCDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGGVA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
LIG3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DNA Ligase III GST (N-Term) Protein

  • DNA ligase 3
  • DNA Ligase III
  • EC 6.5.1.1
  • LIG2
  • LIG3
  • ligase II, DNA, ATP-dependent
  • ligase III, DNA, ATP-dependent
  • Polydeoxyribonucleotide synthase [ATP] 3

Background

This gene is a member of the DNA ligase family. Each member of this family encodes a protein that catalyzes the joining of DNA ends but they each have a distinct role in DNA metabolism. The protein encoded by this gene is involved in excision repair and is located in both the mitochondria and nucleus, with translation initiation from the upstream start codon allowing for transport to the mitochondria and translation initiation from a downstream start codon allowing for transport to the nucleus. Additionally, alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87154
Species: Hu
Applications: COMET, ICC/IF, IHC,  IHC-P, KD, mIF, WB
NBP2-16182
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-41190
Species: Ch, Hu, Mu
Applications: B/N, ICC/IF, IP, PLA, WB
NB100-119
Species: Hu, Mu
Applications: ICC/IF,  IHC-P, IP, In vitro, RIA, WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, COMET, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, mIF, PLA, Simple Western, WB
NBP2-38600
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NB100-106
Species: Hu, Mu, Po, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-94064
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-74611
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-119
Species: Hu, Mu
Applications: ICC/IF,  IHC-P, IP, In vitro, RIA, WB
NBP3-15704
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-89463
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00004595-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, KD, WB
NB500-704
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-2566
Species: Hu
Applications: IB, WB
MAB2476
Species: Hu
Applications: IHC, WB
NBP3-35804
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB

Publications for DNA Ligase III Recombinant Protein (H00003980-P01) (0)

There are no publications for DNA Ligase III Recombinant Protein (H00003980-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Ligase III Recombinant Protein (H00003980-P01) (0)

There are no reviews for DNA Ligase III Recombinant Protein (H00003980-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNA Ligase III Recombinant Protein (H00003980-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNA Ligase III Products

Research Areas for DNA Ligase III Recombinant Protein (H00003980-P01)

Find related products by research area.

Blogs on DNA Ligase III.

PARP Antibody Assays aid both Apoptosis and Cancer Research
The PARP (Poly(ADP-ribose) polymerase) protein is a zinc-dependant nuclear enzyme whose main role is to detect and repair DNA single-strand breaks (SSB). However, PARP antibody research has revealed there are at least 17 PARP proteins, which also play...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DNA Ligase III GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LIG3