DNA Ligase III Antibody

Images

 
Western Blot: DNA Ligase III Antibody [NBP1-87720] - Analysis in human cell line A-549.
Immunocytochemistry/ Immunofluorescence: DNA Ligase III Antibody [NBP1-87720] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP1-87720] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP1-87720] - Staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.
Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP1-87720] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP1-87720] - Staining of human prostate shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP1-87720] - Staining of human skeletal muscle shows weak nuclear positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNA Ligase III Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKE
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DNA Ligase III Protein (NBP1-87720PEP)
Publications
Read Publications using
NBP1-87720 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity in mouse reported in scientific literature (PMID:20807885).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNA Ligase III Antibody

  • DNA ligase 3
  • DNA ligase III
  • EC 6.5.1.1
  • LIG2
  • ligase II, DNA, ATP-dependent
  • ligase III, DNA, ATP-dependent
  • Polydeoxyribonucleotide synthase [ATP] 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87154
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-16182
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87720
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-119
Species: Ba, Ch, Fi, Ha, Hu, Mu, Rb
Applications: ICC/IF, IHC-P, IP, In vitro, RIA, WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
NBP2-38600
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NB100-106
Species: Hu, Mu, Po, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-94064
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-74611
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-119
Species: Ba, Ch, Fi, Ha, Hu, Mu, Rb
Applications: ICC/IF, IHC-P, IP, In vitro, RIA, WB
AF3296
Species: Hu, Mu, Rt
Applications: WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-89463
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00004595-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
NB500-704
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00002189-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, KD, WB
MAB2476
Species: Hu
Applications: IHC, WB
NBP2-98957
Species: Hu
Applications: ICC/IF, IHC, IP, RIA, WB

Publications for DNA Ligase III Antibody (NBP1-87720)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for DNA Ligase III Antibody (NBP1-87720) (0)

There are no reviews for DNA Ligase III Antibody (NBP1-87720). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNA Ligase III Antibody (NBP1-87720) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNA Ligase III Products

Bioinformatics Tool for DNA Ligase III Antibody (NBP1-87720)

Discover related pathways, diseases and genes to DNA Ligase III Antibody (NBP1-87720). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA Ligase III Antibody (NBP1-87720)

Discover more about diseases related to DNA Ligase III Antibody (NBP1-87720).
 

Pathways for DNA Ligase III Antibody (NBP1-87720)

View related products by pathway.

PTMs for DNA Ligase III Antibody (NBP1-87720)

Learn more about PTMs related to DNA Ligase III Antibody (NBP1-87720).
 

Research Areas for DNA Ligase III Antibody (NBP1-87720)

Find related products by research area.

Blogs on DNA Ligase III.

PARP Antibody Assays aid both Apoptosis and Cancer Research
The PARP (Poly(ADP-ribose) polymerase) protein is a zinc-dependant nuclear enzyme whose main role is to detect and repair DNA single-strand breaks (SSB). However, PARP antibody research has revealed there are at least 17 PARP proteins, which also play...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA Ligase III Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIG3