DNA Ligase III Antibody

Images

 
Western Blot: DNA Ligase III Antibody [NBP1-87720] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: DNA Ligase III Antibody [NBP1-87720] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP1-87720] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
Western Blot: DNA Ligase III Antibody [NBP1-87720] - Analysis in human cell line A-549.
Immunocytochemistry/ Immunofluorescence: DNA Ligase III Antibody [NBP1-87720] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNA Ligase III Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DNA Ligase III Protein (NBP1-87720PEP)
Publications
Read Publications using
NBP1-87720 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNA Ligase III Antibody

  • DNA ligase 3
  • DNA ligase III
  • EC 6.5.1.1
  • LIG2
  • ligase II, DNA, ATP-dependent
  • ligase III, DNA, ATP-dependent
  • Polydeoxyribonucleotide synthase [ATP] 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-41190
Species: Hu, Mu, Ch
Applications: WB, B/N, ICC/IF, IP, PLA
NB100-119
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP2-38600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-106
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
NB100-74611
Species: Hu
Applications: WB, IHC-P, IP
NB100-119
Species: Hu, Mu
Applications: WB, ICC/IF, IP
AF3296
Species: Hu, Mu, Rt
Applications: WB
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-48053
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1032
Species: Hu, Mu, Rt, Ba
Applications: WB, ICC/IF, IHC
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
H00002189-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
MAB2476
Species: Hu
Applications: WB, IHC
H00007516-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for DNA Ligase III Antibody (NBP1-87720)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for DNA Ligase III Antibody (NBP1-87720) (0)

There are no reviews for DNA Ligase III Antibody (NBP1-87720). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNA Ligase III Antibody (NBP1-87720) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNA Ligase III Products

Bioinformatics Tool for DNA Ligase III Antibody (NBP1-87720)

Discover related pathways, diseases and genes to DNA Ligase III Antibody (NBP1-87720). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA Ligase III Antibody (NBP1-87720)

Discover more about diseases related to DNA Ligase III Antibody (NBP1-87720).
 

Pathways for DNA Ligase III Antibody (NBP1-87720)

View related products by pathway.

PTMs for DNA Ligase III Antibody (NBP1-87720)

Learn more about PTMs related to DNA Ligase III Antibody (NBP1-87720).
 

Research Areas for DNA Ligase III Antibody (NBP1-87720)

Find related products by research area.

Blogs on DNA Ligase III.

PARP Antibody Assays aid both Apoptosis and Cancer Research
The PARP (Poly(ADP-ribose) polymerase) protein is a zinc-dependant nuclear enzyme whose main role is to detect and repair DNA single-strand breaks (SSB). However, PARP antibody research has revealed there are at least 17 PARP proteins, which also play...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA Ligase III Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIG3