DNA Ligase III Antibody

Western Blot: DNA Ligase III Antibody [NBP1-87720] - Analysis in human cell line A-549.

Immunocytochemistry/Immunofluorescence: DNA Ligase III Antibody [NBP1-87720] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP1-87720] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP1-87720] - Staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.

Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP1-87720] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP1-87720] - Staining of human prostate shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP1-87720] - Staining of human skeletal muscle shows weak nuclear positivity in myocytes.

Product Discontinued

DNA Ligase III Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKE
• Predicted Species: Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LIG3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DNA Ligase III Protein (NBP1-87720PEP)

Reactivity Notes

Reactivity in mouse reported in scientific literature (PMID:20807885).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DNA Ligase III Antibody

• DNA ligase 3
• DNA Ligase III
• EC 6.5.1.1
• LIG2
• LIG3
• ligase II, DNA, ATP-dependent
• ligase III, DNA, ATP-dependent
• Polydeoxyribonucleotide synthase [ATP] 3

Background

DNA Ligase III is a member of the DNA ligase family. Each member of this family encodes a protein that catalyzes the joining of DNA ends but they each have a distinct role in DNA metabolism. The protein encoded by this gene is involved in excision repair and is located in both the mitochondria and nucleus, with translation initiation from the upstream start codon allowing for transport to the mitochondria and translation initiation from a downstream start codon allowing for transport to the nucleus. Additionally, alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DNA Ligase III Antibody (NBP1-87720)(2)

Publications using NBP1-87720

• Tadi SK, Tellier-Lebegue C, Nemoz C et al. PAXX Is an Accessory c-NHEJ Factor that Associates with Ku70 and Has Overlapping Functions with XLF. Cell Rep 2016-10-04 [PMID: 27705800] (WB, Human)
• Fan J, Li L, Small D et al. Cells expressing FLT3/ITD mutations exhibit elevated repair errors generated through alternative NHEJ pathways: implications for genomic instability and therapy. Blood 2010-12-01 [PMID: 20807885]

Bioinformatics

• Gene Symbol: LIG3