DMRTA1 Antibody - BSA Free

Western Blot: DMRTA1 Antibody [NBP1-91838] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue

Immunohistochemistry-Paraffin: DMRTA1 Antibody [NBP1-91838] - Staining of human kidney shows moderate cytoplasmic and membranous positivity in cells in tubules.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DMRTA1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YSNKPDSILSPHPGEQSGGEESPRSLSSSDLESGNESEWVKDLTATKASLPTVSSRPRDPLDILTKIFPNYRRSRLEGILRFCK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DMRTA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DMRTA1 Protein (NBP1-91838PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DMRTA1 Antibody - BSA Free

• DMO
• DMRT-like family A1
• doublesex- and mab-3-related transcription factor A1
• MGC163307
• MGC163309

Background

DMRTA1, also known as Doublesex and mab-3-related transcription factor A1, is a 53.1 kDa, 504 amino acid protein that is expressed in the prostate, pancreas, liver, and kidney as a member of the DMRT family. Current research is exploring the involvement of the protein with prostatitis and metabolic acidosis. The protein interacts with STAT5B and ORC5 proteins in transcription pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DMRTA1