DMRTB1 Antibody - BSA Free

Immunohistochemistry-Paraffin: DMRTB1 Antibody [NBP2-32390] - Staining in human testis and prostate tissues using anti-DMRTB1 antibody. Corresponding DMRTB1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DMRTB1 Antibody [NBP2-32390] - Staining of human prostate shows low expression as expected.

Immunohistochemistry-Paraffin: DMRTB1 Antibody [NBP2-32390] - Staining of human testis shows high expression.

ChIP-Exo-Seq composite graph for Anti-DMRTB1 (NBP2-32390) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DMRTB1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DMRTB1 Antibody - BSA Free (NBP2-32390) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FLVPVKGHAGKCRWKQCLCEKCYLISERQKIMAAQKVLKTQAAEEEQEAALC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DMRTB1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DMRTB1 Protein (NBP2-32390PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DMRTB1 Antibody - BSA Free

• DMRT-like family B with proline-rich C-terminal, 1
• doublesex- and mab-3-related transcription factor B1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DMRTB1