Dlx6 Antibody (2D7)

Images

 
Western Blot: Dlx6 Antibody (2D7) [H00001750-M06] - Analysis of DLX6 expression in transfected 293T cell line by DLX6 monoclonal antibody (M06), clone 2D7. Lane 1: DLX6 transfected lysatE (19.708 KDa). Lane 2: ...read more
Sandwich ELISA: Dlx6 Antibody (2D7) [H00001750-M06] - Detection limit for recombinant GST tagged DLX6 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Dlx6 Antibody (2D7) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
DLX6 (XP_376652, 71 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PYASGGGNSYNHRSLAAYPYMSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQ
Specificity
DLX6 - distal-less homeobox 6 (2D7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DLX6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Dlx6 Antibody (2D7)

  • distal-less homeo box 6
  • distal-less homeobox 6
  • homeobox protein DLX-6
  • MGC125282
  • MGC125283
  • MGC125284
  • MGC125285

Background

This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Dlx6 Antibody (H00001750-M06) (0)

There are no publications for Dlx6 Antibody (H00001750-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dlx6 Antibody (H00001750-M06) (0)

There are no reviews for Dlx6 Antibody (H00001750-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dlx6 Antibody (H00001750-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dlx6 Products

Research Areas for Dlx6 Antibody (H00001750-M06)

Find related products by research area.

Blogs on Dlx6

There are no specific blogs for Dlx6, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dlx6 Antibody (2D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol DLX6
Entrez
Uniprot