Dlx6 Antibody (2D7)

Images

 
Western Blot: Dlx6 Antibody (2D7) [H00001750-M06] - Analysis of DLX6 expression in transfected 293T cell line by DLX6 monoclonal antibody (M06), clone 2D7. Lane 1: DLX6 transfected lysatE (19.708 KDa). Lane 2: ...read more
Sandwich ELISA: Dlx6 Antibody (2D7) [H00001750-M06] - Detection limit for recombinant GST tagged DLX6 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Dlx6 Antibody (2D7) Summary

Immunogen
DLX6 (XP_376652, 71 a.a. - 160 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PYASGGGNSYNHRSLAAYPYMSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQ
Specificity
DLX6 - distal-less homeobox 6 (2D7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DLX6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Dlx6 Antibody (2D7)

  • distal-less homeo box 6
  • distal-less homeobox 6
  • homeobox protein DLX-6
  • MGC125282
  • MGC125283
  • MGC125284
  • MGC125285

Background

This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85793
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001746-M06
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
H00001745-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-1334
Species: Hu, Mu, Po, Bv, Ca
Applications: PEP-ELISA
AF3876
Species: Hu, Mu
Applications: WB, IHC
NBP2-24646
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-481
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-24715
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
H00001750-M06
Species: Hu
Applications: WB, ELISA

Publications for Dlx6 Antibody (H00001750-M06) (0)

There are no publications for Dlx6 Antibody (H00001750-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dlx6 Antibody (H00001750-M06) (0)

There are no reviews for Dlx6 Antibody (H00001750-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dlx6 Antibody (H00001750-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dlx6 Products

Bioinformatics Tool for Dlx6 Antibody (H00001750-M06)

Discover related pathways, diseases and genes to Dlx6 Antibody (H00001750-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dlx6 Antibody (H00001750-M06)

Discover more about diseases related to Dlx6 Antibody (H00001750-M06).
 

Pathways for Dlx6 Antibody (H00001750-M06)

View related products by pathway.

PTMs for Dlx6 Antibody (H00001750-M06)

Learn more about PTMs related to Dlx6 Antibody (H00001750-M06).
 

Research Areas for Dlx6 Antibody (H00001750-M06)

Find related products by research area.

Blogs on Dlx6

There are no specific blogs for Dlx6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dlx6 Antibody (2D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol DLX6
Entrez
Uniprot