Dlx6 Antibody (2D7)

Western Blot: Dlx6 Antibody (2D7) [H00001750-M06] - Analysis of DLX6 expression in transfected 293T cell line by DLX6 monoclonal antibody (M06), clone 2D7. Lane 1: DLX6 transfected lysatE (19.708 KDa). Lane 2: Non-transfected lysate.

Sandwich ELISA: Dlx6 Antibody (2D7) [H00001750-M06] - Detection limit for recombinant GST tagged DLX6 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, S-ELISA
• Clone: 2D7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

Dlx6 Antibody (2D7) Summary

• Immunogen: DLX6 (XP_376652, 71 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PYASGGGNSYNHRSLAAYPYMSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQ
• Specificity: DLX6 - distal-less homeobox 6 (2D7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DLX6
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Dlx6 Antibody (2D7)

• distal-less homeo box 6
• distal-less homeobox 6
• homeobox protein DLX-6
• MGC125282
• MGC125283
• MGC125284
• MGC125285

Background

This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DLX6
• Entrez:
  • 1750(Human)
• Uniprot:
  • XP_376652.2(Human)