Dlx1 Antibody (4B7)


Western Blot: Dlx1 Antibody (4B7) [H00001745-M15] - Analysis of DLX1 expression in Raw 264.7.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA

Order Details

Dlx1 Antibody (4B7) Summary

DLX1 (NP_835221, 181 a.a. - 254 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQL*
DLX1 (4B7)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Dlx1 Antibody (4B7)

  • distal-less homeo box 1
  • distal-less homeobox 1
  • homeobox protein DLX-1


This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. The encoded protein may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 2. Alternatively spliced transcript variants encoding different isoforms have been described.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP, ICC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: IHC, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA

Publications for Dlx1 Antibody (H00001745-M15) (0)

There are no publications for Dlx1 Antibody (H00001745-M15).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dlx1 Antibody (H00001745-M15) (0)

There are no reviews for Dlx1 Antibody (H00001745-M15). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dlx1 Antibody (H00001745-M15) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Dlx1 Products

Bioinformatics Tool for Dlx1 Antibody (H00001745-M15)

Discover related pathways, diseases and genes to Dlx1 Antibody (H00001745-M15). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dlx1 Antibody (H00001745-M15)

Discover more about diseases related to Dlx1 Antibody (H00001745-M15).

Pathways for Dlx1 Antibody (H00001745-M15)

View related products by pathway.

PTMs for Dlx1 Antibody (H00001745-M15)

Learn more about PTMs related to Dlx1 Antibody (H00001745-M15).

Research Areas for Dlx1 Antibody (H00001745-M15)

Find related products by research area.

Blogs on Dlx1

There are no specific blogs for Dlx1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Dlx1 Antibody (4B7) and receive a gift card or discount.


Gene Symbol DLX1