DKC1 Antibody (2W2V6)

Western Blot: DKC1 Antibody (2W2V6) [NBP3-16405] - Western blot analysis of extracts of PC-3 cells, using DKC1 Rabbit mAb (NBP3-16405) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Western Blot: DKC1 Antibody (2W2V6) [NBP3-16405] - Western blot analysis of extracts of various cell lines, using DKC1 Rabbit mAb (NBP3-16405) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry: DKC1 Antibody (2W2V6) [NBP3-16405] - Immunohistochemistry analysis of DKC1 in paraffin-embedded human cervix cancer tissue using DKC1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: DKC1 Antibody (2W2V6) [NBP3-16405] - Immunohistochemistry analysis of DKC1 in paraffin-embedded mouse brain tissue using DKC1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: DKC1 Antibody (2W2V6) [NBP3-16405] - Immunohistochemistry analysis of DKC1 in paraffin-embedded mouse colon tissue using DKC1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clone: 2W2V6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

DKC1 Antibody (2W2V6) Summary

• Description: Novus Biologicals Rabbit DKC1 Antibody (2W2V6) (NBP3-16405) is a recombinant monoclonal antibody validated for use in IHC, WB and ELISA. Anti-DKC1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human DKC1 (O60832). VMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAKIKRVIMERDTYPRKWGLGPKASQKKLMIKQGLLDK
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: DKC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 58 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DKC1 Antibody (2W2V6)

• CBF5 homolog
• CBF5
• cbf5p homolog
• DKC
• dyskeratosis congenita 1, dyskerin
• Dyskerin
• EC 5.4.99
• EC 5.4.99.-
• FLJ97620
• H/ACA ribonucleoprotein complex subunit 4
• NAP57
• NOLA4dyskerin
• Nopp140-associated protein of 57 kDa
• Nucleolar protein family A member 4
• Nucleolar protein NAP57
• snoRNP protein DKC1
• XAP101

Background

DKC1 is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the NOLA1, 2 and 3 proteins. The protein encoded by this gene and the three NOLA proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. These four H/ACA snoRNP proteins are also components of the telomerase complex. The protein encoded by this gene is related to the Saccharomyces cerevisiae Cbf5p and Drosophila melanogaster Nop60B proteins. The gene lies in a tail-to-tail orientation with the palmitoylated erythrocyte membrane protein gene and is transcribed in a telomere to centromere direction. Both nucleotide substitutions and single trinucleotide repeat polymorphisms have been found in this gene. Mutations in this gene cause X-linked dyskeratosis congenita, a disease resulting in reticulate skin pigmentation, mucosal leukoplakia, nail dystrophy, and progressive bone marrow failure in most cases. Mutations in this gene also cause Hoyeraal-Hreidarsson syndrome, which is a more severe form of dyskeratosis congenita. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DKC1 Antibody (NBP3-16405)(1)

Publication using NBP3-16405

• Forino NM, Woo JZ, Zaug AJ et al. Dissecting telomerase RNA structural heterogeneity in living human cells with DMS-MaPseq bioRxiv : the preprint server for biology 2023-10-05 [PMID: 37873413] (WB, Human)

Bioinformatics

• Gene Symbol: DKC1