Dishevelled-1 Recombinant Protein Antigen

Images

 
There are currently no images for Dishevelled-1 Recombinant Protein Antigen (NBP3-17787PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Dishevelled-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Dishevelled-1

Source: E. coli

Amino Acid Sequence: PWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DVL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17787.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Dishevelled-1 Recombinant Protein Antigen

  • dishevelled 1 (homologous to Drosophila dsh)
  • dishevelled, dsh homolog 1 (Drosophila)
  • Dishevelled1
  • Dishevelled-1
  • DSH homolog 1
  • Dsh
  • DVL
  • DVL1
  • DVL1L1
  • MGC54245
  • segment polarity protein dishevelled homolog DVL-1

Background

DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 is a candidate gene for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP1-32388
Species: Hu, Mu, Ze
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP2-38846
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
5036-WN
Species: Hu
Applications: BA, BA
NBP1-86960
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-46367
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-24768
Species: Ch, Hu, Mu, Pm, Rt, Xp, Ze
Applications: IHC,  IHC-P, WB
NBP1-90242
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
AF4815
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-47470
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-89679
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF1927
Species: Hu
Applications: IP, WB
NBP1-55270
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for Dishevelled-1 Recombinant Protein Antigen (NBP3-17787PEP) (0)

There are no publications for Dishevelled-1 Recombinant Protein Antigen (NBP3-17787PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dishevelled-1 Recombinant Protein Antigen (NBP3-17787PEP) (0)

There are no reviews for Dishevelled-1 Recombinant Protein Antigen (NBP3-17787PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Dishevelled-1 Recombinant Protein Antigen (NBP3-17787PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dishevelled-1 Products

Research Areas for Dishevelled-1 Recombinant Protein Antigen (NBP3-17787PEP)

Find related products by research area.

Blogs on Dishevelled-1

There are no specific blogs for Dishevelled-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Dishevelled-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DVL1