Recombinant Human Dishevelled-1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Dishevelled-1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human DVL1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DVL1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Dishevelled-1 Protein

  • dishevelled 1 (homologous to Drosophila dsh)
  • dishevelled, dsh homolog 1 (Drosophila)
  • Dishevelled1
  • Dishevelled-1
  • DSH homolog 1
  • Dsh
  • DVL
  • DVL1
  • DVL1L1
  • MGC54245
  • segment polarity protein dishevelled homolog DVL-1

Background

DVL1 - dishevelled, dsh homolog 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP1-32388
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24674
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46367
Species: Hu
Applications: WB, IHC
NBP2-24768
Species: Hu, Mu, Rt, Ch, Pm, Xp, Ze
Applications: WB, IHC-P
NBL1-07321
Species: Hu
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
AF1927
Species: Hu
Applications: WB, IP, ICC
NBP2-30532
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Dishevelled/Dvl1 Partial Recombinant Protein (H00001855-Q01) (0)

There are no publications for Dishevelled/Dvl1 Partial Recombinant Protein (H00001855-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dishevelled/Dvl1 Partial Recombinant Protein (H00001855-Q01) (0)

There are no reviews for Dishevelled/Dvl1 Partial Recombinant Protein (H00001855-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dishevelled/Dvl1 Partial Recombinant Protein (H00001855-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dishevelled-1 Products

Bioinformatics Tool for Dishevelled/Dvl1 Partial Recombinant Protein (H00001855-Q01)

Discover related pathways, diseases and genes to Dishevelled/Dvl1 Partial Recombinant Protein (H00001855-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dishevelled/Dvl1 Partial Recombinant Protein (H00001855-Q01)

Discover more about diseases related to Dishevelled/Dvl1 Partial Recombinant Protein (H00001855-Q01).
 

Pathways for Dishevelled/Dvl1 Partial Recombinant Protein (H00001855-Q01)

View related products by pathway.

PTMs for Dishevelled/Dvl1 Partial Recombinant Protein (H00001855-Q01)

Learn more about PTMs related to Dishevelled/Dvl1 Partial Recombinant Protein (H00001855-Q01).
 

Research Areas for Dishevelled/Dvl1 Partial Recombinant Protein (H00001855-Q01)

Find related products by research area.

Blogs on Dishevelled-1

There are no specific blogs for Dishevelled-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Dishevelled-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DVL1
Entrez