We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DISC1 Recombinant Protein Antigen

Images

 
There are currently no images for DISC1 Recombinant Protein Antigen (NBP2-76538PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DISC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DISC1.

Source: E. coli

Amino Acid Sequence: LQARMFVLEAKDQQLRREIEEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPPETIRSLQERIKSLNLSLKEITTKVCMSEKFCSTLRKKVNDIET

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DISC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-76538.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DISC1 Recombinant Protein Antigen

  • C1orf136
  • DISC1
  • disrupted in schizophrenia 1 protein
  • disrupted in schizophrenia 1
  • FLJ13381
  • FLJ21640
  • FLJ25311
  • FLJ41105
  • KIAA0457
  • SCZD9

Background

The Disrupted In Schizophrenia gene locus DISC is associated with patients afflicted with schizophrenia as a result of chromosomal translocations. DISC-1 encodes a large protein predicted to contain a globular N-terminal domain and a helical C-terminal domain, both of which have the potential to form interactions with other proteins. DISC-1 interacts with proteins involved in the centrosome and cytoskeletal system, including MIPT3, MAP1A and NUDEL; proteins which localize receptors to membranes, including alpha-actinin 2 an beta 4-spectrin; and proteins which transduce signals from membrane receptors, including ATF-4 and ATF-5. Therefore, DISC-1 is thought to be involved in intracellular transport, neurite architecture and/or neuronal migration, all of which are thought to be pathogenic in the schizophrenic brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85299
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01086
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15954
Species: Hu, Rt
Applications: IHC,  IHC-P, KO, WB
NBP2-01171
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-83908
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80665
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-53816
Species: Hu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
DBD00
Species: Hu
Applications: ELISA
NBP3-48516
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-02559
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00054820-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP3-25636
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-47470
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-92892
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB100-61071
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB1131
Species: Hu
Applications: ICC, IHC, WB
NBP2-76538PEP
Species: Hu
Applications: AC

Publications for DISC1 Recombinant Protein Antigen (NBP2-76538PEP) (0)

There are no publications for DISC1 Recombinant Protein Antigen (NBP2-76538PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DISC1 Recombinant Protein Antigen (NBP2-76538PEP) (0)

There are no reviews for DISC1 Recombinant Protein Antigen (NBP2-76538PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DISC1 Recombinant Protein Antigen (NBP2-76538PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DISC1 Products

Research Areas for DISC1 Recombinant Protein Antigen (NBP2-76538PEP)

Find related products by research area.

Blogs on DISC1.

Calnexin - an ER chaperone that folds the cell's glycoproteins
Calnexin is an abundant 90kDa chaperone protein that resides in the membrane of the endoplasmic reticulum. Calnexin and the related calreticulin protein function together to ensure the proper folding of glycoproteins. By binding to partially folded...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DISC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DISC1