DISC1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

DISC1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DISC1.
  
  

  Source: E. coli

  Amino Acid Sequence: LQARMFVLEAKDQQLRREIEEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPPETIRSLQERIKSLNLSLKEITTKVCMSEKFCSTLRKKVNDIET

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: DISC1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-76538.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DISC1 Recombinant Protein Antigen

• C1orf136
• DISC1
• disrupted in schizophrenia 1 protein
• disrupted in schizophrenia 1
• FLJ13381
• FLJ21640
• FLJ25311
• FLJ41105
• KIAA0457
• SCZD9

Background

The Disrupted In Schizophrenia gene locus DISC is associated with patients afflicted with schizophrenia as a result of chromosomal translocations. DISC-1 encodes a large protein predicted to contain a globular N-terminal domain and a helical C-terminal domain, both of which have the potential to form interactions with other proteins. DISC-1 interacts with proteins involved in the centrosome and cytoskeletal system, including MIPT3, MAP1A and NUDEL; proteins which localize receptors to membranes, including alpha-actinin 2 an beta 4-spectrin; and proteins which transduce signals from membrane receptors, including ATF-4 and ATF-5. Therefore, DISC-1 is thought to be involved in intracellular transport, neurite architecture and/or neuronal migration, all of which are thought to be pathogenic in the schizophrenic brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: DISC1