DIO1 Antibody (1E4.)

Images

 
There are currently no images for DIO1 Antibody (H00001733-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1E4.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DIO1 Antibody (1E4.) Summary

Immunogen
DIO1 (NP_000783.2, 35 a.a. - 125 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNFGSCT
Specificity
DIO1 - deiodinase, iodothyronine, type I (1E4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DIO1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DIO1 Antibody (1E4.)

  • 5DI
  • deiodinase, iodothyronine, type I
  • DIOI
  • EC 1.97.1
  • EC 1.97.1.10
  • ITDI1
  • MGC130050
  • thyroxine deiodinase type I (selenoprotein)
  • TXDI1MGC130051
  • Type 1 DI
  • type I iodothyronine deiodinase
  • Type-I 5'-deiodinase

Background

The protein encoded by this gene is a thiol-requiring propylthiouracil-sensitive oxidoreductase. It activates thyroid hormone by converting the prohormone thyroxine (T4) by outer ring deiodination (ORD) to bioactive 3,3',5-triiodothyronine (T3). It also degrades both hormones by inner ring deiodination (IRD). Alternative splicing results in multiple transcript variants encoding different isoforms. Some, but not all, isoforms contain a selenocysteine (Sec) residue encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Additional transcript variants have been described but are not supported by experimental evidence. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05767
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, IHC-P
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
1670-SE
Species: Ec
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for DIO1 Antibody (H00001733-M01) (0)

There are no publications for DIO1 Antibody (H00001733-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIO1 Antibody (H00001733-M01) (0)

There are no reviews for DIO1 Antibody (H00001733-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DIO1 Antibody (H00001733-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DIO1 Products

DIO1 H00001733-M01

Bioinformatics Tool for DIO1 Antibody (H00001733-M01)

Discover related pathways, diseases and genes to DIO1 Antibody (H00001733-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIO1 Antibody (H00001733-M01)

Discover more about diseases related to DIO1 Antibody (H00001733-M01).
 

Pathways for DIO1 Antibody (H00001733-M01)

View related products by pathway.

PTMs for DIO1 Antibody (H00001733-M01)

Learn more about PTMs related to DIO1 Antibody (H00001733-M01).

Blogs on DIO1

There are no specific blogs for DIO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DIO1 Antibody (1E4.) and receive a gift card or discount.

Bioinformatics

Gene Symbol DIO1
Entrez
Uniprot