DHX16 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit DHX16 Antibody - BSA Free (NBP2-87270) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of DHX16. Peptide sequence: RREYLAKREREKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DHX16 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for DHX16 Antibody - BSA Free
Background
DHX16, also known as Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16, is a 119.3 kDa 1,041 amino acid protein and is engaged in pre-mRNA splicing and unwinding RNA as a part of the DEAD box protein family. Current research is being conducted with the protein involving diseases such as adenocarcinoma, ataxia, esophagitis, erythematosus, and malaria. The protein interacts in mRNA processing and spliceosome pathways with other proteins such as GPKOW, SF3B2, COIL, DHX38, and MEGF10.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Av, Bv, Sh
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA, WB
Species: Hu
Applications: WB
Publications for DHX16 Antibody (NBP2-87270) (0)
There are no publications for DHX16 Antibody (NBP2-87270).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DHX16 Antibody (NBP2-87270) (0)
There are no reviews for DHX16 Antibody (NBP2-87270).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DHX16 Antibody (NBP2-87270) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DHX16 Products
Research Areas for DHX16 Antibody (NBP2-87270)
Find related products by research area.
|
Blogs on DHX16