DHRS9 Antibody (3E3)

Images

 
Western Blot: DHRS9 Antibody (3E3) [H00010170-M06] - Analysis of DHRS9 expression in transfected 293T cell line by DHRS9 monoclonal antibody (M06), clone 3E3. Lane 1: DHRS9 transfected lysatE (35.2 KDa). Lane 2: ...read more
Immunoprecipitation: DHRS9 Antibody (3E3) [H00010170-M06] - Analysis of DHRS9 transfected lysate using anti-DHRS9 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with DHRS9 rabbit polyclonal antibody.
Sandwich ELISA: DHRS9 Antibody (3E3) [H00010170-M06] - Detection limit for recombinant GST tagged DHRS9 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP, S-ELISA
Clone
3E3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DHRS9 Antibody (3E3) Summary

Immunogen
DHRS9 (AAH58883, 1 a.a. ~ 319 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV
Specificity
DHRS9 - dehydrogenase/reductase (SDR family) member 9 (3E3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DHRS9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DHRS9 Antibody (3E3)

  • dehydrogenase/reductase (SDR family) member 9,3alpha-HSD
  • EC 1.1
  • EC 1.1.1
  • EC 1.1.1.105
  • member 4,3-alpha-HSD
  • NADP-dependent retinol dehydrogenase/reductase
  • RDH15
  • RDH-E2
  • RDHL3ALPHA-HSD
  • RDHTBE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-79775
Species: Hu
Applications: WB, IHC, IHC-P, PA
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
MAB6529
Species: Hu
Applications: WB, Simple Western
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87117
Species: Hu
Applications: WB, IHC, IHC-P
AF5759
Species: Hu, Mu
Applications: WB
MAB7450
Species: Hu
Applications: IHC
NBP1-31378
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-30446
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86615
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-32431
Species: Hu
Applications: IHC, IHC-P
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010170-M06
Species: Hu
Applications: WB, ELISA, IP, S-ELISA

Publications for DHRS9 Antibody (H00010170-M06) (0)

There are no publications for DHRS9 Antibody (H00010170-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHRS9 Antibody (H00010170-M06) (0)

There are no reviews for DHRS9 Antibody (H00010170-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DHRS9 Antibody (H00010170-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DHRS9 Products

Bioinformatics Tool for DHRS9 Antibody (H00010170-M06)

Discover related pathways, diseases and genes to DHRS9 Antibody (H00010170-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHRS9 Antibody (H00010170-M06)

Discover more about diseases related to DHRS9 Antibody (H00010170-M06).
 

Pathways for DHRS9 Antibody (H00010170-M06)

View related products by pathway.

PTMs for DHRS9 Antibody (H00010170-M06)

Learn more about PTMs related to DHRS9 Antibody (H00010170-M06).

Blogs on DHRS9

There are no specific blogs for DHRS9, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHRS9 Antibody (3E3) and receive a gift card or discount.

Bioinformatics

Gene Symbol DHRS9
Entrez
Uniprot