DHRS2 Antibody (1F10) - Azide and BSA Free

Sandwich ELISA: DHRS2 Antibody (1F10) [H00010202-M03] - Detection limit for recombinant GST tagged DHRS2 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1F10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DHRS2 Antibody (1F10) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse DHRS2 Antibody (1F10) - Azide and BSA Free (H00010202-M03) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: DHRS2 (NP_878912.1, 229 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GFMGMSLSGRTSRNIISCRGLGSQRTVQESCPSCALQMPATSTGRTLRWQATPLGSERSGGGCVAVVPGPGA
• Specificity: DHRS2 - dehydrogenase/reductase (SDR family) member 2 (1F10)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DHRS2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DHRS2 Antibody (1F10) - Azide and BSA Free

• dehydrogenase/reductase (SDR family) member 2
• dehydrogenase/reductase member 2
• dehydrogenase/reductase SDR family member 2
• Dicarbonyl reductase HEP27
• EC 1.1.1.-
• EC 1.1.1.184
• HEP27
• Protein D
• SDR25C1
• short chain dehydrogenase/reductase family 25C, member 1
• short-chain alcohol dehydrogenase family member

Background

DHRS2 may inhibit cell replication either by catalyzing the oxidation of estrogen and androgen or by converting cortisone in cortisol

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DHRS2
• Entrez:
  • 10202(Human)
• Uniprot:
  • NP_878912(Human)