DGCR8 Antibody - BSA Free

Western Blot: DGCR8 Antibody [NBP1-57261] - Hela cell lysate, Antibody Titration: 0.2-1 ug/ml

Immunohistochemistry-Paraffin: DGCR8 Antibody [NBP1-57261] - Human Liver tissue, 5 ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DGCR8 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to DGCR8(DiGeorge syndrome critical region gene 8) The peptide sequence was selected from the N terminal of DGCR8. Peptide sequence DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: DGCR8.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DGCR8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 5 ug/ml
  • Immunohistochemistry-Paraffin 5 ug/ml
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DGCR8 Antibody - BSA Free

• C22orf12
• DGCRK6chromosome 22 open reading frame 12
• DiGeorge syndrome critical region 8
• DiGeorge syndrome critical region gene 8
• Gy1
• microprocessor complex subunit DGCR8
• pasha

Background

DGCR8 contains 2 DRBM (double-stranded RNA-binding) domains and 1 WW domain. It may play a part in the etiology of the velocardiofacial/DiGeorge syndrome (VCFS/DGS), a developmental disorder characterized by structural and functional palate anomalies, conotruncal cardiac malformations, immunodeficiency, hypocalcemia, and typical facial anomalies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DGCR8 Antibody (NBP1-57261)(1)

Publication using NBP1-57261

• Yathindar S. Rao, Cody L. Shults, Elena Pinceti, Toni R. Pak Prolonged ovarian hormone deprivation alters the effects of 17 beta -estradiol on microRNA expression in the aged female rat hypothalamus Oncotarget 2015-11-10 [PMID: 26460619]

Bioinformatics

• Gene Symbol: DGCR8
• Uniprot:
  • Q8WYQ5(Human)