DGCR2 Antibody

Images

 
Immunohistochemistry-Paraffin: DGCR2 Antibody [NBP1-84255] - Staining of human pancreas shows strong cytoplasmic positivity in islet cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DGCR2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RFSRKCPTGWHHYEGTASCYRVYLSGENYWDAAQTCQRLNGSLATFSTDQELRFVLAQEWDQPERSFGWKDQRKLWVGYQYVITGRNRSLEGRWEVAFKGSSEVFLPPDPIFASAMSENDNVFCAQLQCFHFPTLRHHDLHSWHAESCYEKSSFLCKRSQTCVDIKDNVV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DGCR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DGCR2 Protein (NBP1-84255PEP)
Publications
Read Publications using
NBP1-84255 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DGCR2 Antibody

  • DGS-C
  • DiGeorge syndrome critical region gene 2
  • IDDDKFZp686I1730
  • integral membrane protein deleted in DiGeorge syndrome
  • integral membrane protein DGCR2/IDD
  • KIAA0163DiGeorge syndrome critical region protein 2
  • LAN
  • SEZ-12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56149
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF6567
Species: Hu, Mu
Applications: WB, IHC
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-28730
Species: Hu, Mu
Applications: WB, IHC-P, IP
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DGCR2 Antibody (NBP1-84255)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for DGCR2 Antibody (NBP1-84255) (0)

There are no reviews for DGCR2 Antibody (NBP1-84255). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DGCR2 Antibody (NBP1-84255) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DGCR2 Products

Bioinformatics Tool for DGCR2 Antibody (NBP1-84255)

Discover related pathways, diseases and genes to DGCR2 Antibody (NBP1-84255). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DGCR2 Antibody (NBP1-84255)

Discover more about diseases related to DGCR2 Antibody (NBP1-84255).
 

Pathways for DGCR2 Antibody (NBP1-84255)

View related products by pathway.

PTMs for DGCR2 Antibody (NBP1-84255)

Learn more about PTMs related to DGCR2 Antibody (NBP1-84255).

Blogs on DGCR2

There are no specific blogs for DGCR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DGCR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DGCR2
Entrez
Uniprot