Recombinant Human DGAT2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DGAT2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 388 of Human DGAT2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLNRSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
DGAT2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DGAT2 Protein

  • DGAT2
  • diacylglycerol O-acyltransferase 2
  • diacylglycerol O-acyltransferase homolog 2 (mouse)
  • diacylglycerol O-acyltransferase homolog 2
  • diacylglycerol O-acyltransferase-like protein 2
  • Diglyceride acyltransferase 2
  • DKFZp686A15125
  • EC 2.3.1
  • EC 2.3.1.20
  • GS1999FULL

Background

Acyl-CoA:diacylglycerol acyltransferase, or DGAT (EC 2.3.1.20), is responsible for the synthesis of triglycerides. It catalyzes a reaction in which diacylglycerol is covalently joined to long chain fatty acyl-CoAs.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41487
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
NBP2-49395
Species: Hu
Applications: IHC
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-50444
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF7550
Species: Hu
Applications: WB
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-49154
Species: Hu
Applications: IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
H00084649-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for DGAT2 Recombinant Protein (H00084649-P01) (0)

There are no publications for DGAT2 Recombinant Protein (H00084649-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DGAT2 Recombinant Protein (H00084649-P01) (0)

There are no reviews for DGAT2 Recombinant Protein (H00084649-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DGAT2 Recombinant Protein (H00084649-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DGAT2 Products

Bioinformatics Tool for DGAT2 Recombinant Protein (H00084649-P01)

Discover related pathways, diseases and genes to DGAT2 Recombinant Protein (H00084649-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DGAT2 Recombinant Protein (H00084649-P01)

Discover more about diseases related to DGAT2 Recombinant Protein (H00084649-P01).
 

Pathways for DGAT2 Recombinant Protein (H00084649-P01)

View related products by pathway.

PTMs for DGAT2 Recombinant Protein (H00084649-P01)

Learn more about PTMs related to DGAT2 Recombinant Protein (H00084649-P01).

Blogs on DGAT2.

Can you DGAT? DGAT1 & DGAT2 Antibodies for Metabolic Pathway Research
Triacylglycerols (triglycerides) (TGs) are the major storage molecules of metabolic energy and FAs in most living organisms. Excessive accumulation of TGs, however, is associated with human diseases, such as obesity, diabetes mellitus, and steatohepat...  Read full blog post.

Customers Who Bought This Also Bought

DGAT2 Antibody
NBP1-71701

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DGAT2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DGAT2
Entrez