Recombinant Human Dexras1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Dexras1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-281 of Human RASD1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGGDPGDAFGIVAPFARRPSVHSDLMYIREKASAGSQAKDKERCVIS

Protein/Peptide Type
Recombinant Protein
Gene
RASD1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Dexras1 Protein

  • Activator of G-protein signaling 1
  • AGS1ras-related protein
  • DEXRAS1dexamethasone-induced Ras-related protein 1
  • MGC:26290
  • RAS, dexamethasone-induced 1

Background

This gene encodes a Ras-related protein that is stimulated by dexamethasone. The exact function of this gene is unknown, but it may play a role in dexamethasone-induced alterations in cell morphology, growth and cell-extracellular matrix interactions. In addition, studies of a similar rat protein suggest that it functions as as a novel physiologic nitric oxide (NO) effector. The gene product belongs to the Ras superfamily of small GTPases. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82775
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-91968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
H00022800-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP2-56902
Species: Hu
Applications: WB, ICC/IF
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38151
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010411-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00051655-P02
Species: Hu
Applications: WB, ELISA, PA

Publications for Dexras1 Recombinant Protein (H00051655-P02) (0)

There are no publications for Dexras1 Recombinant Protein (H00051655-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dexras1 Recombinant Protein (H00051655-P02) (0)

There are no reviews for Dexras1 Recombinant Protein (H00051655-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dexras1 Recombinant Protein (H00051655-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dexras1 Products

Bioinformatics Tool for Dexras1 Recombinant Protein (H00051655-P02)

Discover related pathways, diseases and genes to Dexras1 Recombinant Protein (H00051655-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dexras1 Recombinant Protein (H00051655-P02)

Discover more about diseases related to Dexras1 Recombinant Protein (H00051655-P02).
 

Pathways for Dexras1 Recombinant Protein (H00051655-P02)

View related products by pathway.

PTMs for Dexras1 Recombinant Protein (H00051655-P02)

Learn more about PTMs related to Dexras1 Recombinant Protein (H00051655-P02).
 

Research Areas for Dexras1 Recombinant Protein (H00051655-P02)

Find related products by research area.

Blogs on Dexras1

There are no specific blogs for Dexras1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Dexras1 Antibody
NBP1-91830

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Dexras1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RASD1