DEXI Antibody - BSA Free

Western Blot: DEXI Antibody [NBP1-81015] - Analysis in control (vector only transfected HEK293T lysate) and DEXI over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415520).

Immunocytochemistry/Immunofluorescence: DEXI Antibody [NBP1-81015] - Staining of human cell line U-251 MG shows localization to nuclear speckles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DEXI Antibody [NBP1-81015] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: DEXI Antibody [NBP1-81015] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: DEXI Antibody [NBP1-81015] - Staining of human adrenal gland shows moderate to strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DEXI Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DEXI Antibody - BSA Free (NBP1-81015) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-DEXI Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE
• Predicted Species: Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DEXI
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DEXI Protein (NBP1-81015PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31435002).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DEXI Antibody - BSA Free

• dexamethasone-induced transcript
• Dexi homolog (mouse)
• MYLEdexamethasone-induced protein
• Protein MYLE

Background

DEXI( AAH01083, 1 a.a. - 96 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DEXI Antibody (NBP1-81015)(1)

Publication using NBP1-81015

• Nieves-Bonilla JM, Kiaf B, Schuster C, Kissler S The type 1 diabetes candidate gene Dexi does not affect disease risk in the nonobese diabetic mouse model Genes Immun. 2019-08-22 [PMID: 31435002] (WB, Mouse)

Bioinformatics

• Gene Symbol: DEXI
• Entrez:
  • 28955(Human)