Desmocollin-3 Antibody (4D2)

Images

 
Western Blot: Desmocollin-3 Antibody (4D2) [H00001825-M01] - DSC3 monoclonal antibody (M01), clone 4D2 Western Blot analysis of DSC3 expression in A-431 ( Cat # L015V1 ).
Immunocytochemistry/ Immunofluorescence: Desmocollin-3 Antibody (4D2) [H00001825-M01] - Analysis of monoclonal antibody to DSC3 on A-431 cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: Desmocollin-3 Antibody (4D2) [H00001825-M01] - Detection limit for recombinant GST tagged DSC3 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Desmocollin-3 Antibody (4D2) Summary

Immunogen
DSC3 (NP_001932 585 a.a. - 684 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CKPKMGYTDILAVDPDEPVHGAPFYFSLPNTSPEISRLWSLTKVNDTAARLSYQKNAGFQEYTIPITVKDRAGQAATKLLRVNLCECTHPTQCRATSRST
Specificity
DSC3 - desmocollin 3
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DSC3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Desmocollin-3 Antibody (4D2)

  • Cadherin family member 3
  • CDHF3
  • CDHF3HT-CP
  • desmocollin 3
  • Desmocollin3
  • Desmocollin-3
  • desmocollin-4
  • DSC
  • DSC1
  • DSC2
  • DSC3
  • DSC4
  • DSC4desmocollin-3
  • HT-CP

Background

The protein encoded by this gene is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation. The desmosomal family members are arranged in two clusters on chromosome 18, occupying less than 650 kb combined. Alternative splicing results in two transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
MAB944
Species: Hu
Applications: WB, IHC
NBP1-78984
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF947
Species: Hu
Applications: WB, Simple Western
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NB100-56146
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
44260002
Species: Hu
Applications: WB, ELISA
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-43312
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
NBL1-16214
Species: Hu
NBP2-12553
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-86078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Desmocollin-3 Antibody (H00001825-M01) (0)

There are no publications for Desmocollin-3 Antibody (H00001825-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Desmocollin-3 Antibody (H00001825-M01) (0)

There are no reviews for Desmocollin-3 Antibody (H00001825-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Desmocollin-3 Antibody (H00001825-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Desmocollin-3 Products

Bioinformatics Tool for Desmocollin-3 Antibody (H00001825-M01)

Discover related pathways, diseases and genes to Desmocollin-3 Antibody (H00001825-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Desmocollin-3 Antibody (H00001825-M01)

Discover more about diseases related to Desmocollin-3 Antibody (H00001825-M01).
 

Pathways for Desmocollin-3 Antibody (H00001825-M01)

View related products by pathway.

PTMs for Desmocollin-3 Antibody (H00001825-M01)

Learn more about PTMs related to Desmocollin-3 Antibody (H00001825-M01).

Blogs on Desmocollin-3

There are no specific blogs for Desmocollin-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Desmocollin-3 Antibody (4D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol DSC3
Entrez
OMIM
Uniprot