DERP6 Antibody

Images

 
Western Blot: DERP6 Antibody [NBP1-57705] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DERP6 Antibody Summary

Immunogen
Synthetic peptides corresponding to C17ORF81 The peptide sequence was selected from the C terminal of C17ORF81. Peptide sequence FSILPDFSLDLQEGPSVESQPYSDPHIPPVSKNAKARTRKCSLVSGHGRE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ELP5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against C17orf81 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DERP6 Antibody

  • chromosome 17 open reading frame 81
  • dermal papilla derived protein 6
  • dermal papilla-derived protein 6
  • DERP6
  • MST071
  • MSTP071
  • S-phase 2 protein

Background

C17orf81 belongs to the ELP5 family. C17orf81 may be involved in TP53-mediated transcriptional regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91733
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC, IF
NBP1-84625
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16321
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84276
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81176
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13876
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57792
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-86851
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89727
Species: Hu
Applications: IHC, IHC-P
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000395-M01
Species: Hu
Applications: WB, ELISA
NBP1-56848
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Sh
Applications: WB
NB100-56082
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-13934
Species: Hu
Applications: IHC, IHC-P

Publications for DERP6 Antibody (NBP1-57705) (0)

There are no publications for DERP6 Antibody (NBP1-57705).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DERP6 Antibody (NBP1-57705) (0)

There are no reviews for DERP6 Antibody (NBP1-57705). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DERP6 Antibody (NBP1-57705) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DERP6 Products

Bioinformatics Tool for DERP6 Antibody (NBP1-57705)

Discover related pathways, diseases and genes to DERP6 Antibody (NBP1-57705). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DERP6 Antibody (NBP1-57705)

Discover more about diseases related to DERP6 Antibody (NBP1-57705).
 

Pathways for DERP6 Antibody (NBP1-57705)

View related products by pathway.

PTMs for DERP6 Antibody (NBP1-57705)

Learn more about PTMs related to DERP6 Antibody (NBP1-57705).

Blogs on DERP6

There are no specific blogs for DERP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DERP6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELP5
Uniprot