DEPDC1A Antibody - BSA Free

Western Blot: DEPDC1A Antibody [NBP2-84002] - Host: Rabbit. Target Name: HIRIP3. Sample Type: 293T. Antibody Dilution: 1.0ug/mlDEPDC1 is supported by BioGPS gene expression data to be expressed in HEK293T

Western Blot: DEPDC1A Antibody [NBP2-84002] - WB Suggested Anti-DEPDC1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human brain

Western Blot: DEPDC1A Antibody [NBP2-84002] - Host: Rabbit. Target Name: WT1. Sample Type: 721_B. Antibody Dilution: 1.0ug/mlDEPDC1 is supported by BioGPS gene expression data to be expressed in 721_B

Western Blot: DEPDC1A Antibody [NBP2-84002] - Host: Rabbit. Target Name: SERPINA3. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml

Western Blot: DEPDC1A Antibody [NBP2-84002] - Host: Rabbit. Target Name: EGFL8. Sample Type: Hela. Antibody Dilution: 1.0ug/mlDEPDC1 is supported by BioGPS gene expression data to be expressed in HeLa

Western Blot: DEPDC1A Antibody [NBP2-84002] - Host: Rabbit. Target Name: FAM46C. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DEPDC1A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DEPDC1A Antibody - BSA Free (NBP2-84002) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DEPDC1A. Peptide sequence: PEPLLTFEYYELFVNILVVCGYITVSDRSSGIHKIQDDPQSSKFLHLNNL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DEPDC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DEPDC1A Antibody - BSA Free

• cell cycle control protein SDP35
• DEP domain containing 1,5830484J08Rik
• DEP domain-containing protein 1A
• DEP.8
• DEPDC1ADEPDC1-V2
• FLJ20354
• SDP35

Background

DEPDC1a is a protein that is expressed frequently in bladder cancer cells. DEPDC1a is also significantly up-regulated in DCIS and IDC breast cancers. It seems to be important for the proliferation, as well as the migration and invasion, of cancer cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DEPDC1