DENND1C Antibody

Images

 
Western Blot: DENND1C Antibody [NBP1-94052] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: DENND1C Antibody [NBP1-94052] - Staining of human colon.
Immunohistochemistry-Paraffin: DENND1C Antibody [NBP1-94052] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.
Immunohistochemistry-Paraffin: DENND1C Antibody [NBP1-94052] - Staining of human liver shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: DENND1C Antibody [NBP1-94052] - Staining in human lymph node and liver tissues using anti-DENND1C antibody. Corresponding DENND1C RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: DENND1C Antibody [NBP1-94052] - Staining of human bone marrow, colon, liver and lymph node using Anti-DENND1C antibody NBP1-94052 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: DENND1C Antibody [NBP1-94052] - Staining of human bone marrow.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DENND1C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PLSPEDEGCPWAEEALDSSFLGSGEELDLLSEILDSLSMGAKSAGSLRPSQSLDCCHRGDLDSCFSLPNIPRWQPDDKKL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DENND1C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DENND1C Protein (NBP1-94052PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DENND1C Antibody

  • connecdenn 3
  • DENN domain-containing protein 1C
  • DENN/MADD domain containing 1C
  • FAM31C
  • family with sequence similarity 31, member C
  • FLJ22757

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77033
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
H00057706-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
NBP2-20042
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
MAB7745
Species: Hu
Applications: IHC, KO, Simple Western, WB
H00023258-B01P
Species: Hu
Applications: ICC/IF, WB
NBP2-60771
Species: Hu, Mu, Pm, Rt, Sh
Applications: WB
NBP2-26116
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-92308
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-90976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-93980
Species: Hu, Rt
Applications: WB
H00004218-M02
Species: Hu, Mu, Ze
Applications: ELISA, ICC/IF, IHC, WB
NB100-74359
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-83950
Species: Hu
Applications: IHC, IHC-P, WB
H00026119-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-89545
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16382
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-32715
Species: Hu, Mu
Applications: ICC/IF, WB
H00005873-M02
Species: Hu, Mu, Rb
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB

Publications for DENND1C Antibody (NBP1-94052) (0)

There are no publications for DENND1C Antibody (NBP1-94052).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DENND1C Antibody (NBP1-94052) (0)

There are no reviews for DENND1C Antibody (NBP1-94052). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DENND1C Antibody (NBP1-94052) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DENND1C Products

Bioinformatics Tool for DENND1C Antibody (NBP1-94052)

Discover related pathways, diseases and genes to DENND1C Antibody (NBP1-94052). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DENND1C

There are no specific blogs for DENND1C, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DENND1C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DENND1C